[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55030.1"

            "Lipoate-protein ligase B"
LIPB_THEFY  "RecName: Full=Octanoyltransferase;         EC=2.3.1.181;AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase;AltName: Full=Lipoyl/octanoyl transferase;AltName: Full=Lipoate-protein ligase B;"

OrgPattern ------------------111----------------------------------------2------ 1111111111111111111-111111111111111111121111111111111111111111111111111-----------1--1111111-111-1111111111111------------------------1-111-1---1111111111111111111111111111111111111111111111-1----------------------------------------1------------------------------------------------------------------------------------------11---------------11-----------------1------1111---1--111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1--11-1111-111-11111111111-1-------------------------111111111111111111111111111111111-1111111-11111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1111-----------------------------------------------11 --------211-111111-1111111111111111111111111-11111111-11-----111111111111111111111111111-1211111111112111--13-2-1121-111-1111111111--111--1111121-1---11111-1-11121111111171-212222M2221222531332221111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKSVSELLYHWLGESPVPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPW:Sequence : EEEEEcccccTTcHHHHHHHHHHHHHHccTTcTccEEEEEccccEEEEcTTccHH:Sec Str :============================================================:RP:SCP|1->216|1w66A1|5e-50|55.3|206/216|d.104.1.3 :============================================================:BL:SWS|1->236|LIPB_THEFY|e-140|100.0|236/236 61: . . . * . .: 120 :DRPLTDPGAPVIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDF:Sequence :HHccHHHTcEEEEcccccccEEEcTTEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHT:Sec Str : ################ :PROS|76->91|PS01313|LIPB|PDOC01017| :============================================================:RP:SCP|1->216|1w66A1|5e-50|55.3|206/216|d.104.1.3 :============================================================:BL:SWS|1->236|LIPB_THEFY|e-140|100.0|236/236 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|64->166|PF03099|7e-07|35.4|96/118|BPL_LplA_LipB 121: . . + . . .: 180 :GLSGMRVEGRTGVWLAAAPDRGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVP:Sequence :TcccEEEcccccTTcccccTTccccccTTcEEETTETTEEEEEEEEEccccHHHHHHHTc:Sec Str :============================================================:RP:SCP|1->216|1w66A1|5e-50|55.3|206/216|d.104.1.3 :============================================================:BL:SWS|1->236|LIPB_THEFY|e-140|100.0|236/236 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|64->166|PF03099|7e-07|35.4|96/118|BPL_LplA_LipB 181: . * . . . .: 240 :CGIRDAGVTSLTAELDRTVGVGDILEATEHHLAAVLGASSYRRIAGWPVLPEFVDA :Sequence :cccccTTcTcccGGGTccccHHHHHHHHHHHHHHHHTEccccEEEHHHHHHHH :Sec Str :==================================== :RP:SCP|1->216|1w66A1|5e-50|55.3|206/216|d.104.1.3 :======================================================== :BL:SWS|1->236|LIPB_THEFY|e-140|100.0|236/236