[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55030.1 tfus0 AAZ55030.1 "Lipoate-protein ligase B"
MKSVSELLYHWLGESPVPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPW
DRPLTDPGAPVIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDF
GLSGMRVEGRTGVWLAAAPDRGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVP
CGIRDAGVTSLTAELDRTVGVGDILEATEHHLAAVLGASSYRRIAGWPVLPEFVDA
//