[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55194.1"

            "imidazole glycerol phosphate synthase subunit hisF"
HIS6_THEFY  "RecName: Full=Imidazole glycerol phosphate synthase subunit hisF;         EC=4.1.3.-;AltName: Full=IGP synthase cyclase subunit;AltName: Full=IGP synthase subunit hisF;AltName: Full=ImGP synthase subunit hisF;         Short=IGPS subunit hisF;"

OrgPattern ---2--2111111112-1112112222222222222223222222222322222-1-112-1----22 2221222222222222222-22222222222222222222222222232222222222--222222222122222222--21122222222222-----2-222222223---------------222222223222222233322222222222223223222222222223122334233222222212222222222222222222222222222222122222222221-22222222222222222-2----22-2---22--22----2-222-------222------------------------2----2----22-2222222-2-2222222---2-2--1212222222222222212--22222222-----222222322222222222222222222222222222-2222222322222222222222222332222222222222222-----------------------------2322222222222222222222222222222222222222222222222232224233222222222222222222214231222212222-2223223222222213342222333333-1-------22222222222222222222222222222222222222--222222222222222222222222222-2222222222222222222222223322222222222222222222222222-22222221222222-1-----333322321222222-2221---2222222222222323222222222222222--------222222222222224222222222222222232112222--------------------------------------1--2-212221 ------1-----111111111111211111111111111111111111111111-111111111111111111111111111111-11-12111111111121111-11----------------------------------------------------------------3-1-118111111113111111111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLAVRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNR:Sequence :HHcccEEEEEEEEETTEETTccccTTcccTTcHHHHHHHHHHHTccEEEEEEcccHHHHH:Sec Str : ==========================================================:RP:SCP|3->256|1gpwA|2e-85|51.2|248/253|c.1.2.1 :============================================================:BL:SWS|1->256|HIS6_THEFY|e-132|100.0|256/256 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->215|PF00977|1e-63|65.8|202/229|His_biosynth 61: . . . * . .: 120 :ETTYDVVRRTAEQVFIPLTVGGGVRSTEDVDRLLRAGADKVSINTAAVRRPELIREIAQE:Sequence :HHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHTccEEEEcHHHHHcTHHHHHHHHH:Sec Str :============================================================:RP:SCP|3->256|1gpwA|2e-85|51.2|248/253|c.1.2.1 :============================================================:BL:SWS|1->256|HIS6_THEFY|e-132|100.0|256/256 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->215|PF00977|1e-63|65.8|202/229|His_biosynth 121: . . + . . .: 180 :FGSQVLVLSADVRRTVNGTATPSGFEITTHGGRQGTGIDAVEWVQQAEELGAGEILLNSM:Sequence :HcGGGEEEEEEEEEETcHHHHcTEEEEEETTTTEEEEEEHHHHHHHHHHTTccEEEEEET:Sec Str :============================================================:RP:SCP|3->256|1gpwA|2e-85|51.2|248/253|c.1.2.1 :============================================================:BL:SWS|1->256|HIS6_THEFY|e-132|100.0|256/256 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->215|PF00977|1e-63|65.8|202/229|His_biosynth 181: . * . . . .: 240 :DADGTKSGFDLELIRAVRKAVNVPLIASGGAGAVEHFAPAVDAGANAVLAASVFHFGEIT:Sequence :TTTTccccccHHHHHHHGGGccccEEEEcccccHHHHHHHHHTTccEEEEcHHHHTTccc:Sec Str : XXXXXXXXXXXXXXXX :SEG|218->233|apavdaganavlaasv :============================================================:RP:SCP|3->256|1gpwA|2e-85|51.2|248/253|c.1.2.1 :============================================================:BL:SWS|1->256|HIS6_THEFY|e-132|100.0|256/256 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->215|PF00977|1e-63|65.8|202/229|His_biosynth 241: + . . . . *: 300 :ISDVKAELRAKGYPVR :Sequence :HHHHHHHHHHTTcccc :Sec Str :================ :RP:SCP|3->256|1gpwA|2e-85|51.2|248/253|c.1.2.1 :================ :BL:SWS|1->256|HIS6_THEFY|e-132|100.0|256/256