[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55194.1 tfus0 AAZ55194.1 "imidazole glycerol phosphate synthase subunit hisF"
MSLAVRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNR
ETTYDVVRRTAEQVFIPLTVGGGVRSTEDVDRLLRAGADKVSINTAAVRRPELIREIAQE
FGSQVLVLSADVRRTVNGTATPSGFEITTHGGRQGTGIDAVEWVQQAEELGAGEILLNSM
DADGTKSGFDLELIRAVRKAVNVPLIASGGAGAVEHFAPAVDAGANAVLAASVFHFGEIT
ISDVKAELRAKGYPVR
//