[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55274.1"

            "putative reductase"
            ""

OrgPattern -------------------------------------------------------------------1 -1--3--2222---1---------------------4111-133---1------------22----12341-------------------------1------------1----------------------------------1------------------------1-------------1-------------------------------------2-11-------1-------------------------------------------------------------------------------------------1--------------------------1---------------------------1--------11------11----------1-111112-112--2-----123111----------------------------------------------------------------1-1111--------------------------11---------------1--1--------------111--------------------------------2---------------------------------1--1-------------------------1-----------------------------------------------------------------------------------------------------------1-----------------------1-------------1---------------------------1----------------------------------------------------------------------------- -------------1------1111-1-----------------------1-------------------------------------1---------------1------1-----------------------------------------------------1---------1------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MISRTGRPTAGHAEGSRREPPLRLVVVVASARKGRNGGCVAQWFLEQTTGRSELEVDTVD:Sequence : EEEEEEcccccTTccTHHHHHHHHHHHTcTTcEEEEEE:Sec Str : XXXX :SEG|25->28|vvvv : =========================================:RP:SCP|20->213|2fzvA1|6e-24|19.1|188/233|c.23.5.4 61: . . . * . .: 120 :TAVFPLPPEPHRDPDPTTVQVLSRLTPRLRRADMFVFVVPEYNRSFPASVKSLIDWHTAE:Sequence :ccccccHHHHHHTTcccccccccccGGGGGGccEEEEEEEccTTcccHHHHHHHTTcHHH:Sec Str : XXXXXXXXXXXX :SEG|65->76|plppephrdpdp :============================================================:RP:SCP|20->213|2fzvA1|6e-24|19.1|188/233|c.23.5.4 : =================================:BL:SWS|88->137|FMNR_SCHPO|1e-09|48.0|50/200 121: . . + . . .: 180 :WEAKPVGFVSYGGRSGGLRAVEHLGQVFTELHAVTVRNTVSFHSVEEQFDSEGRPKSPEA:Sequence :HHTcEEEEEEEEcccTTHHHHHHHHHHHHHTTcEEcccGGGGcccEEEccTTccccccHH:Sec Str :============================================================:RP:SCP|20->213|2fzvA1|6e-24|19.1|188/233|c.23.5.4 :================= :BL:SWS|88->137|FMNR_SCHPO|1e-09|48.0|50/200 181: . * . . . .: 240 :CAVAAQNLLDQLVWWGRALRRAREESPYRGSARDIRSQMIEEPQYVR :Sequence :HHHHHHHHHHHHHHHHHHHHccTTTcc :Sec Str :================================= :RP:SCP|20->213|2fzvA1|6e-24|19.1|188/233|c.23.5.4