[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55283.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----1-------------------------------1----121---1------------1---2-11121---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRIGITGHSNLTADSMDLVRQALTEALTPYADGELVGVSCLARGADQLFAEAVLAVGGQL:Sequence 61: . . . * . .: 120 :EVVLPSADYRETKVKPDNLEQFDRLLVRSSLVRYMSHLTAGRQAYEDANEAVIGSVDRLF:Sequence 121: . . + . . .: 180 :AVWDGQPASGKGGTADAVAAARARGVPVDVIWPEGARRE :Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|130->150|gkggtadavaaarargvpvdv