[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55328.1"

            "similar to ABC-type branched-chain amino acid transport systems periplasmic component"
            ""

OrgPattern 11--------------1-21123-2---2-13-----------1-1-2----------------1--- -------1111---1------3---2------2222111111-21----1--1-----11324-2-211-222223111---2--------------------------------------------1-11--3--1---1---24-1141121111------1-21111-------------4221-11--------------------1--------4311--------31------------------------11-----11--11---11-------1---11111111111111-------------1111111111221-41111111-1---------2-1--4--62233372--11---3-12--------1111-1ECA1-13576333453543536-337218291-1-722122464422371--212-111413--------5---15-2-----------------------------2-----5C99A98BACA43332BBD8444424CAE5755-3545615347BC4FI135-1-143----------55A156-127237533413332152-2333322-A---1-222221----------11----111-21------------------------------1------2-2--2-1111111111-111111111111-111111222--11-211222122221212111111111--111111111111--------------1112-------------------------1111111311311111312--------------------------------------------------------1---------------------------1-2--13111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------1--1-1-------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNMRKSWSRTLLAATGATALLAAAACGTNEAGESSSTGEGLPDTIKIMSIKEMTGPVSFA:Sequence : EEEEccEEcEEEEEccccTTHHH:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|10->28|tllaatgatallaaaacgt : ==================:RP:SCP|43->371|1usgA|4e-51|22.0|323/345|c.93.1.1 : ================:BL:SWS|45->392|LIVB7_BRUAB|2e-21|25.7|338/399 61: . . . * . .: 120 :GENSTKGIDLAVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPG:Sequence :HHHHHHHHHHHHTHHHHHcEEcTccccEEEEETTccHHHHHHHHHHTTccTcccEEEccc:Sec Str :============================================================:RP:SCP|43->371|1usgA|4e-51|22.0|323/345|c.93.1.1 :============================================================:BL:SWS|45->392|LIVB7_BRUAB|2e-21|25.7|338/399 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->372|PF01094|8e-21|34.0|285/319|ANF_receptor 121: . . + . . .: 180 :LSSQASAISPIAEKGEIPVIYYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKT:Sequence :cHHHHHHHHHcGGGGTTEEEEccccTTGccccTTEEEccccHHHHHHHHHHHHHHHTTcc:Sec Str :============================================================:RP:SCP|43->371|1usgA|4e-51|22.0|323/345|c.93.1.1 :============================================================:BL:SWS|45->392|LIVB7_BRUAB|2e-21|25.7|338/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->372|PF01094|8e-21|34.0|285/319|ANF_receptor 181: . * . . . .: 240 :AAVLYTSGNPTLTELGEKAVPGVIEENGVTIKRSDTVSNDTQDFTAVTSEIIKADPDAVF:Sequence :ccEEEEcTccHHHHHHHHHHHHHHHHHHccccEEEEEccTTHHHHHHHHHHccTTccEEE:Sec Str :============================================================:RP:SCP|43->371|1usgA|4e-51|22.0|323/345|c.93.1.1 :============================================================:BL:SWS|45->392|LIVB7_BRUAB|2e-21|25.7|338/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->372|PF01094|8e-21|34.0|285/319|ANF_receptor 241: + . . . . *: 300 :LLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGEDAAGVVWPSNFSARSEVPST:Sequence :EccccHHHHHHHHHHTTTcTTcEEEEcGccHHHHTcHHHHHHTTcEEEEGGGGccccHHH:Sec Str :============================================================:RP:SCP|43->371|1usgA|4e-51|22.0|323/345|c.93.1.1 :============================================================:BL:SWS|45->392|LIVB7_BRUAB|2e-21|25.7|338/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->372|PF01094|8e-21|34.0|285/319|ANF_receptor 301: . . . . + .: 360 :QEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAKVAAEGFDGAQ:Sequence :HHHHHHTTTcHHHGccHHHHHHHHHHHHHHTHHHTccHHHHHHHHHHHHHcTTccEEETT:Sec Str :============================================================:RP:SCP|43->371|1usgA|4e-51|22.0|323/345|c.93.1.1 :============================================================:BL:SWS|45->392|LIVB7_BRUAB|2e-21|25.7|338/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->372|PF01094|8e-21|34.0|285/319|ANF_receptor 361: . . . * . .: 420 :GPLSFENNDVRVEGVIASWNGSEEVVVTLGDD :Sequence :EEEEEcTTccEEEEEEEEEETTEEEEc :Sec Str :=========== :RP:SCP|43->371|1usgA|4e-51|22.0|323/345|c.93.1.1 :================================ :BL:SWS|45->392|LIVB7_BRUAB|2e-21|25.7|338/399 :$$$$$$$$$$$$ :RP:PFM|69->372|PF01094|8e-21|34.0|285/319|ANF_receptor