[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55328.1 tfus0 AAZ55328.1 "similar to ABC-type branched-chain amino acid transport systems periplasmic component"
MNMRKSWSRTLLAATGATALLAAAACGTNEAGESSSTGEGLPDTIKIMSIKEMTGPVSFA
GENSTKGIDLAVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPG
LSSQASAISPIAEKGEIPVIYYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKT
AAVLYTSGNPTLTELGEKAVPGVIEENGVTIKRSDTVSNDTQDFTAVTSEIIKADPDAVF
LLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGEDAAGVVWPSNFSARSEVPST
QEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAKVAAEGFDGAQ
GPLSFENNDVRVEGVIASWNGSEEVVVTLGDD
//