[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55333.1"

            "putative membrane transport protein"
            ""

OrgPattern ------5122222221-11-1------------------------------------1---111---- ----3----------------2---2-----1222237D9-4-7---1-1----2--1----1---34233--------------------------------------------------------------------------1----------------------------------------------1-2222223212223221---1-222-------11111123-------------------------------------------------------------------------------------------------------------------------1---111---11------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------11-1-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAATPAAVPHISPLRVIVPLVLGGLTYAMSQNAIVPVLAEIQRATGSTASEAAWVVTGFF:Sequence : =============================================:BL:SWS|16->413|BMR3_BACSU|4e-13|26.3|391/512 61: . . . * . .: 120 :ISSAVLTVIAGRLGDLFGRKPVLLISLGLFALGGLIAAAGGTLGAVVAGRVIMGVAGGVF:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|82->109|vllislglfalggliaaaggtlgavvag :============================================================:BL:SWS|16->413|BMR3_BACSU|4e-13|26.3|391/512 121: . . + . . .: 180 :PLAFALLGQLLPRDRAAFGMGLVSSMLGLGGALGLPVGGLVAEYFGYQGLFWGSAAMAAG:Sequence : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|139->162|gmglvssmlglggalglpvgglva : XXXXXXXX:SEG|173->186|gsaamaagsvvaia :============================================================:BL:SWS|16->413|BMR3_BACSU|4e-13|26.3|391/512 181: . * . . . .: 240 :SVVAIALLVPEPRRRGRGRVDWIGATLLTFSLTTGLLAVSRGAEWGWSSTPVLALAAVGV:Sequence :XXXXXX :SEG|173->186|gsaamaagsvvaia : XXXXXXX :SEG|193->199|rrrgrgr : XXXXXXXXXXXX :SEG|206->217|tlltfslttgll : XXXXXXXXX:SEG|232->249|vlalaavgviglvvllgv :============================================================:BL:SWS|16->413|BMR3_BACSU|4e-13|26.3|391/512 241: + . . . . *: 300 :IGLVVLLGVERRIPDPLIDLRLMRQRNVWLAHVIGFLTTCGQITTFLLVPQMVQAPAEGG:Sequence :XXXXXXXXX :SEG|232->249|vlalaavgviglvvllgv :============================================================:BL:SWS|16->413|BMR3_BACSU|4e-13|26.3|391/512 301: . . . . + .: 360 :TGLGVGVTQAGLYLLPFSMTTLVGGALTGKAVARFGIRPLMALGAASAVTGLSILAFLPV:Sequence :============================================================:BL:SWS|16->413|BMR3_BACSU|4e-13|26.3|391/512 361: . . . * . .: 420 :QPATVLLGAGITGIGGGTIYSALPVLIAEAVPERETGTVNGINTIIRTIAMAILSQVTTV:Sequence : XXXXXXXXXXXX :SEG|368->379|gagitgigggti : XXXX:SEG|417->429|vttvvlvvgtppg :===================================================== :BL:SWS|16->413|BMR3_BACSU|4e-13|26.3|391/512 421: . . + . . .: 480 :VLVVGTPPGQDYPLRAAFTVDFSMSALLNLLALLLVPCIVVAGARRGRGGGKADAHPKAA:Sequence :XXXXXXXXX :SEG|417->429|vttvvlvvgtppg : XXXXXXXXXX :SEG|446->455|allnllalll : XXXXXXXXXXXX :SEG|462->473|agarrgrgggka : XX:SEG|479->495|aaavrreepaaeeseqr 481: . * . . . .: 540 :AVRREEPAAEESEQRSWPPS :Sequence :XXXXXXXXXXXXXXX :SEG|479->495|aaavrreepaaeeseqr