[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55333.1 tfus0 AAZ55333.1 "putative membrane transport protein"
MAATPAAVPHISPLRVIVPLVLGGLTYAMSQNAIVPVLAEIQRATGSTASEAAWVVTGFF
ISSAVLTVIAGRLGDLFGRKPVLLISLGLFALGGLIAAAGGTLGAVVAGRVIMGVAGGVF
PLAFALLGQLLPRDRAAFGMGLVSSMLGLGGALGLPVGGLVAEYFGYQGLFWGSAAMAAG
SVVAIALLVPEPRRRGRGRVDWIGATLLTFSLTTGLLAVSRGAEWGWSSTPVLALAAVGV
IGLVVLLGVERRIPDPLIDLRLMRQRNVWLAHVIGFLTTCGQITTFLLVPQMVQAPAEGG
TGLGVGVTQAGLYLLPFSMTTLVGGALTGKAVARFGIRPLMALGAASAVTGLSILAFLPV
QPATVLLGAGITGIGGGTIYSALPVLIAEAVPERETGTVNGINTIIRTIAMAILSQVTTV
VLVVGTPPGQDYPLRAAFTVDFSMSALLNLLALLLVPCIVVAGARRGRGGGKADAHPKAA
AVRREEPAAEESEQRSWPPS
//