[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55377.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------2--2--2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKTLSYTDALRILGGEDGSSLGELGEALTKGTLSALGVPDVLGLHDRLIRHGQNAITGI:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|14->27|lggedgsslgelge 61: . . . * . .: 120 :REKLTGVSRWDRTERVAAADLILRITAFFNALAELLEQHHCPFTLRDLRFTRNEQYRLFS:Sequence : :Sec Str 121: . . + . . .: 180 :DVLRGIEQDTPTLPPASGGPELATPYRKAAGVLLLFLRGLEVWDRLDDAERTRVTETLEE:Sequence : :Sec Str : XXXXXXXXXXX:SEG|170->181|ertrvtetleel 181: . * . . . .: 240 :LPSRACRRHIELYRKLAADVPEFGVWANFSAHEKTQEQITEISTGLDELAQILQKLTTSR:Sequence : :Sec Str :X :SEG|170->181|ertrvtetleel : XXXXX:SEG|236->249|lttsrsrrrltele 241: + . . . . *: 300 :SRRRLTELENLYQAILDKPILDASEAPNGVVLPSVRDAYLDLGGLLRFTDENATPSSEAW:Sequence : :Sec Str :XXXXXXXXX :SEG|236->249|lttsrsrrrltele 301: . . . . + .: 360 :WHEATRYDNLQPLLASLLTQRECLLRPIVLLGHPGAGKSQLTRMLAARLPLGNFLPLRVE:Sequence : HHHHHHHHHHHHHHHHHHHEEEEEEcccccccHHHHHHHHHHHcccccEEEEccc:Sec Str : =======================================:RP:SCP|322->448|1qvrA2|4e-05|30.4|112/357|c.37.1.20 361: . . . * . .: 420 :LRSVPADAPIHTQIDEGISATLHARTSWRDLADEAQDALPVVILDGFDELLQATGVNRSD:Sequence :HHHTTccccHHHHHHHTTccccHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|322->448|1qvrA2|4e-05|30.4|112/357|c.37.1.20 421: . . + . . .: 480 :YLEQVQRFQEHQADLGRPVAVIVTSRTVVAERTRFPFGIPVIRLEPFTDAQIAHLTDVWN:Sequence :HHHHHHGGGEEEEccccccEEEEEEccHHHHHTHHHHHHHHHHHHHHccccccccEEEEE:Sec Str :============================ :RP:SCP|322->448|1qvrA2|4e-05|30.4|112/357|c.37.1.20 481: . * . . . .: 540 :RANTAALAERGLHPITADSLLRYRDLAEQPLLLFMLLIFDADANALQRETADLGRAGLYE:Sequence :EccHHHHHHHHcccccHHHHHHHHHHHHHHHHHTTccHHHHGGGcccccccccccccGGG:Sec Str 541: + . . . . *: 600 :KLLTSFAEREVRKHHPHLYGEELAQAVEDELRSLEVVAIAMFARHQQWVSAEQLEADLAA:Sequence :cGGGGGccGGGccTTccccHHHHHHHHHHHHHTcEEEEE :Sec Str 601: . . . . + .: 660 :LFPGAGVHAEETGLSGHITTSHQVLGRFFFVHEARAIQQGDTRSVYEFLHATFGEHLVAR:Sequence : :Sec Str 661: . . . * . .: 720 :AVVNELARLVEDRAYYARRRAPLPENSDFLFYAFTSFAALAGRAAIVESAAELLAVKAAD:Sequence : :Sec Str : XXXXXXXXX :SEG|673->681|rayyarrra : XXXXXXXXXXXXXX:SEG|707->728|vesaaellavkaadareraayr 721: . . + . . .: 780 :ARERAAYRSLLVDMFREAPYPRPFPKRDYQPFKATITHRLAAYTANLVTLLVLIADEIDL:Sequence : :Sec Str :XXXXXXXX :SEG|707->728|vesaaellavkaadareraayr 781: . * . . . .: 840 :SELFPDSGPPWLPWRELVGTWRSLPGDDWYGLLDTVRMRHLGHWGEDETPRALLCREQRT:Sequence : :Sec Str 841: + . . . . *: 900 :PVNVGECVGFELRVNASGRLEITNPYRLTVPYPNETSRMLRSVSLLMQGWSARLVLMVGP:Sequence : :Sec Str 901: . . . . + .: 960 :YLEHGGSTIGTWAMEEAVYSDPDEEEAEDAHLPIPVSWMPSSDILELRLGPCGVPETAAS:Sequence : :Sec Str : =====================================================:BL:SWS|908->978|GUND_CLOCE|8e-04|35.9|64/100 961: . . . * . .:1020 :RLFRYQRILEWSLSRGFVLGRHEWAALRQAGEELAAIQDATTDPVFREVYQNLRVIIEAH:Sequence : :Sec Str :================== :BL:SWS|908->978|GUND_CLOCE|8e-04|35.9|64/100 1021: . . + . . .:1080 :LHRVEKVMPKRKLLEPVLETLRPHLNDPSVIDRVLDLATS :Sequence : :Sec Str