[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55488.1 tfus0 AAZ55488.1 "hypothetical protein"
MGPHWSQVRLGAKILSATLTFLAGLALAGHEAELWQFSPREEFRLASVSITLLFLSLTAS
AIHQWRSEKSEVTLRNIRQGVTYSLHALLFRIQDETGIDVRDLGATVHLRVRTGIWPFHH
EQLVPLAWARFRATSVSGITWRPGVGVIGRCVTLGRLLIVDVAALDRQLESLTEAEWHEL
AQREQQEPPEQSRTLGMSYREWQRARGKFSVILATPLIGRSSTRPEILGCVSVDVMTPDP
STDSYELLSEEAVQYAVSAAAREISNVLAAFL
//