[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55520.1"

            "putative exported protein"
            ""

OrgPattern 4411115788988865-14121-94222313511111111111111111111111111111223--12 --1-5---------8PB55-5D--88555556HBHC3CCC-D1B--------111--1--226--116-61-----------------------------------------------------------------11111---1----------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------1-----------6222-------44611154652-----------------2---16--111-----1--12--1-1------12----------------------------------------------31D4--D767---11------1111------1-B1CB9-1---11-221-3258--1----------------51--D25------------1--1-1--------1----------------------------------1--2-------12------2---------------------------------------------------------------------------------------------------------------------1---------------------------111112-------1---------------------------------------------1111--------------------------------------------------- ------1-412-11-122121112122111111111221212211111121111-11111111--------------------------12-2---------1111-2--111111--211-121113-392-3122-11--2112-1-11222211132241211121121131-------------11--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNITPTAIAGLGMTQLGKVYGRTPAEFAVEAVTRAAADAGLALADIDGLLVNPGVNNDTD:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|25->50|aefaveavtraaadaglaladidgll : XXX:SEG|58->79|dtdlrlqstlqlrdlrllttiq 61: . . . * . .: 120 :LRLQSTLQLRDLRLLTTIQGFGSSAIQMVQYASMAISAGMANVVACVYADAPLKEGRGSG:Sequence : ccccccHHHHHHHHHHHHTTcccEEEEEEEEcccccccHHH:Sec Str :XXXXXXXXXXXXXXXXXXX :SEG|58->79|dtdlrlqstlqlrdlrllttiq 121: . . + . . .: 180 :AAYAGGNRPLTGVEALPAAAGLKSAPARYAIAARRHMETYGTTSEQLGAVAVAARAWAAM:Sequence :HHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHTTTTTTTcccEEEEEEcTTTc:Sec Str : XXXXXXXXXXX :SEG|169->179|avavaarawaa : ===================================:BL:SWS|146->346|Y793_METTH|7e-33|35.8|201/383 181: . * . . . .: 240 :NPLAQMREPITIDDHQNSRMIADPLRLLDCCLVSNGAIAIIVTSAERAADLAQPPVHIWG:Sequence :cEEEEEcTTccHHHHHTccccccccccccccccEEEEEEEEEEEHHHHHHTccccEEEEE:Sec Str : ================================:RP:SCP|209->290|2ebfX2|2e-07|9.0|78/219|c.150.1.2 :============================================================:BL:SWS|146->346|Y793_METTH|7e-33|35.8|201/383 241: + . . . . *: 300 :WGQAHPGYTSYRDSNFGLVSGAAQSGPAALRMAGVTVDEIDIREIYDCFTYTTLLTLEDY:Sequence :EEEEEccTTcccccGGGTTcHHHHHHHHHHHHTTccGGGccEEEEccccHHHHHHHHHHH:Sec Str :================================================== :RP:SCP|209->290|2ebfX2|2e-07|9.0|78/219|c.150.1.2 :============================================================:BL:SWS|146->346|Y793_METTH|7e-33|35.8|201/383 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|261->333|PF02803|1e-04|41.3|63/131|Thiolase_C 301: . . . . + .: 360 :GFCAKGEGGEFVASGALAPGGSHPTNTGGGELSSYYMWGMTPLSEAVIQARGQGGQRQVA:Sequence :TccGGHGGGGcTTccHHHHc GGccTTccHHHHcccGGGHHHHHHH :Sec Str : XXXXXXXX :SEG|351->358|rgqggqrq :============================================== :BL:SWS|146->346|Y793_METTH|7e-33|35.8|201/383 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|261->333|PF02803|1e-04|41.3|63/131|Thiolase_C 361: . . . * . .: 420 :KNDLIMVSGNGGVLDFHATLIVSPHAKTR :Sequence : :Sec Str