[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55520.1 tfus0 AAZ55520.1 "putative exported protein"
MNITPTAIAGLGMTQLGKVYGRTPAEFAVEAVTRAAADAGLALADIDGLLVNPGVNNDTD
LRLQSTLQLRDLRLLTTIQGFGSSAIQMVQYASMAISAGMANVVACVYADAPLKEGRGSG
AAYAGGNRPLTGVEALPAAAGLKSAPARYAIAARRHMETYGTTSEQLGAVAVAARAWAAM
NPLAQMREPITIDDHQNSRMIADPLRLLDCCLVSNGAIAIIVTSAERAADLAQPPVHIWG
WGQAHPGYTSYRDSNFGLVSGAAQSGPAALRMAGVTVDEIDIREIYDCFTYTTLLTLEDY
GFCAKGEGGEFVASGALAPGGSHPTNTGGGELSSYYMWGMTPLSEAVIQARGQGGQRQVA
KNDLIMVSGNGGVLDFHATLIVSPHAKTR
//