[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55524.1"

            "NADH:flavin oxidoreductases, Old Yellow enzyme family"
            ""

OrgPattern ------1111111121----1--32111-111-----------11----1231-----1--111---- 211-21122221-261122-23--2722222153334BHG12-23-312221223324--2-613-746431111111--622-1-1-1111-------1-2-2-91211---------------1--232-1--111111---1-5122221--11------1--13231------------21211---21222222232122222221223222311112213333332322222222222222222221-13-11----112--11---1321--1111-----------------1111111111111211---1112-1366222222322312BB1-1-3-1-11-1--754131-7-1334-1-13119221-----52567--131222222222221-3-44543434344-7332223455554422112522224553333333334222412------------------------------26B1128514ABEADE5666577A8777818F796666125581111153574232313433211-----111422-9641-1-13---1-111142342111114-21121---------------------1143453-734513555527433333534355---1---------23362552333233322-322233223233322222356565332122222222221212241222222--322333322333---1-----122213443111215---------7766837433519989798B6B8875A69---------1356633333545225634344333------11441111--------2-1------1111---111-11--------1-11-1-1211 ----753-841-12269678877EEE62311111111222222332757CFJKK77332222637123-44861D2211267776815-5U996I44441323CJC-32B---------------------------------2---------------------------57---211----1278HA68721RJRb1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKPRETTQFTHLFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIAYWAARARA:Sequence :HHccccGGGGGGGccEEETTEEEcccEEEcccccccTTTcHHHHHHHHHHHHHTTcHHTc:Sec Str : XXXXXXXXX:SEG|52->67|aywaararaglawvgg : ==================================================:RP:SCP|11->357|1z41A1|1e-46|26.8|328/337|c.1.4.1 61: . . . * . .: 120 :GLAWVGGISAALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQL:Sequence :cTTcEEEEEcEEEEEEEEEccTTcccTTccccEEcccHHHHHHHHHHHcTTTccEEEEcG:Sec Str :XXXXXXX :SEG|52->67|aywaararaglawvgg :============================================================:RP:SCP|11->357|1z41A1|1e-46|26.8|328/337|c.1.4.1 : ===================:BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678 : $$$$$$$$$$$$$$$$$$:RP:PFM|103->345|PF00724|4e-41|41.3|242/340|Oxidored_FMN 121: . . + . . .: 180 :IMQGGMPHGPSPTVTAYVANQVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHD:Sequence :GGGccTTccccTccccccTTcccEEccHTcccTTccccGGGccccccccccHHHHHHHHH:Sec Str :============================================================:RP:SCP|11->357|1z41A1|1e-46|26.8|328/337|c.1.4.1 :============================================================:BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|103->345|PF00724|4e-41|41.3|242/340|Oxidored_FMN 181: . * . . . .: 240 :DLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGY:Sequence :HHHHHHHHTcccccHHHTcccHHHHHHHHHHHHHHHHHHccccccHHHHTcTTcccGGGT:Sec Str :============================================================:RP:SCP|11->357|1z41A1|1e-46|26.8|328/337|c.1.4.1 :============================================================:BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|103->345|PF00724|4e-41|41.3|242/340|Oxidored_FMN 241: + . . . . *: 300 :DAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPV:Sequence :TccEEEEcTTcccHHHHHHHHHHHHHHHHGGGGGccccEEEEcccccccccccEEccccc:Sec Str :============================================================:RP:SCP|11->357|1z41A1|1e-46|26.8|328/337|c.1.4.1 :============================================================:BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|103->345|PF00724|4e-41|41.3|242/340|Oxidored_FMN 301: . . . . + .: 360 :IYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRPCIGCNECIHR:Sequence :ccccEEcEcTTccEEEcGGGHHHHHHHHHTTcccccHHHHHTcTTccccEEEEcTTcccE:Sec Str :========================================================= :RP:SCP|11->357|1z41A1|1e-46|26.8|328/337|c.1.4.1 : =============:RP:SCP|348->544|1ps9A3|6e-24|28.7|178/179|c.4.1.1 :============================================================:BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|103->345|PF00724|4e-41|41.3|242/340|Oxidored_FMN 361: . . . * . .: 420 :RLVDKLPFACAINPYASRELDGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWE:Sequence :EEcccGGGccEEEcGGGGccEEEcccEEcccEEEETTEEEccEEHHHHHTTTTTcTTTTc:Sec Str :============================================================:RP:SCP|348->544|1ps9A3|6e-24|28.7|178/179|c.4.1.1 :============================================================:BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|392->466|PF00070|2e-10|48.4|64/78|Pyr_redox 421: . . + . . .: 480 :REEQLGGQMRIAARAAENAAYHDFVTWQEGRLRRAGVTVELGRTATVDNVLSFDADVVAV:Sequence :cHHHHHHHHTccTTcGGGcHHHHHHHHHHHHHHHTTccEEcHHHHHHHHHHTccccEEEE:Sec Str : XXXXXXXXX :SEG|432->440|aaraaenaa : XXXXXXX:SEG|474->485|dadvvavatgav :============================================================:RP:SCP|348->544|1ps9A3|6e-24|28.7|178/179|c.4.1.1 :============================================================:BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|392->466|PF00070|2e-10|48.4|64/78|Pyr_redox 481: . * . . . .: 540 :ATGAVPRRLPIPGADAPFVVDGHAVLAGTAQIGERVLLTAAEDHMQPLTIAGYLADHGHH:Sequence :cccEEEccccccTTTccccTTccHHHHTccccccEEEEEEcccccHHHHHHHHHHHTTcE:Sec Str :XXXXX :SEG|474->485|dadvvavatgav :============================================================:RP:SCP|348->544|1ps9A3|6e-24|28.7|178/179|c.4.1.1 :============================================================:BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678 541: + . . . . *: 600 :VHLVYQTPGPAPLVGKYTIGAPLAKLTAAGAAFTFMQRVVQIEEGRVATRNIYSDIPGEI:Sequence :EEEEEcccTTTHHHHTTcHHHHHHHHHHTTcEEEETEEEEEETEEEEEETTccccccccc:Sec Str : XXXXXXXXXXXXXXXX :SEG|560->575|gaplakltaagaaftf :==== :RP:SCP|348->544|1ps9A3|6e-24|28.7|178/179|c.4.1.1 :============================================================:BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678 601: . . . . + .: 660 :TGFDSVVVAAGGVPDDSLYHELKRHGKANVHLLGDAYAPRRITFATQQAYALAALV :Sequence :cTccEEEEEccEEEccHHHHHHHHTTccEEEEcGGGTccccHHHHHHHHHHHH :Sec Str :======================= :BL:SWS|102->623|STCD_RHIME|3e-63|32.2|519/678