[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55524.1 tfus0 AAZ55524.1 "NADH:flavin oxidoreductases, Old Yellow enzyme family"
MKPRETTQFTHLFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIAYWAARARA
GLAWVGGISAALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQL
IMQGGMPHGPSPTVTAYVANQVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHD
DLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGY
DAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPV
IYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRPCIGCNECIHR
RLVDKLPFACAINPYASRELDGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWE
REEQLGGQMRIAARAAENAAYHDFVTWQEGRLRRAGVTVELGRTATVDNVLSFDADVVAV
ATGAVPRRLPIPGADAPFVVDGHAVLAGTAQIGERVLLTAAEDHMQPLTIAGYLADHGHH
VHLVYQTPGPAPLVGKYTIGAPLAKLTAAGAAFTFMQRVVQIEEGRVATRNIYSDIPGEI
TGFDSVVVAAGGVPDDSLYHELKRHGKANVHLLGDAYAPRRITFATQQAYALAALV
//