[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55560.1 tfus0 AAZ55560.1 "hypothetical protein"
MRYRYSEAERAAFDIVRAIRVGDADADMAEALGADRLAARAPSDEVIRLRYDRAADHGHE
GLLMLTTALARLALASLTALAQAQHRNLDDLLDDYETHLNTGRSFGNNEER
//