[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55595.1"

            "putative uvrA-like protein"
            ""

OrgPattern ------------------------11111111111---1111111111-1111-------------11 2341432222222211111-12111311111123333233122232132222344212112232322244322224331123111111222223222--2222324242311111111111111222222222222222221113111111111111111111111111111111111111112121111111122222221121122122111112211122113222222231111111111111132223223133112223322332112221111111111111111111111111111111111111111111111112221333234212135111111311111111122211111111111111423111111111112111111111111111111111-221221121111111111111211111111111111111212222221112111111111111--11111111111111111111111112222222222322222224322221222323221122222322232222211111111111111111122121211111111111111112211111114412111111111111111-11111111111111211112121111111111111111112--12222------11121111111111111-11-1111111111111111111111111111111111111111111111111-111111111111--1111111111111112111211111-111111112211121111111222212222111111111111111111111111111132222221111111111111111111111111111111-1-11111111111111111111111111111223 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1----------1--1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVSIDQSAIRGSRRSNPATYTGLLDPIRKAFAKANGVKPSLFSANSEGACPACNGAGVIY:Sequence :EEEEEccccHHHHTccHHHHHHHHHHHHHHHEEEETTEEEEccTTTcTTcEEEEEEcTTc:Sec Str : =======================:RP:SCP|38->103|1d4cA1|3e-06|12.1|66/102|a.138.1.3 :============================================================:BL:SWS|1->251|UVRA_AQUAE|4e-54|47.4|247/926 61: . . . * . .: 120 :TDLAMMAGVATVCETCEGKRFQASVLKYTLGGRTISDVLEMSVREAEEFFRAGEARLPAA:Sequence :cEEEEEEETTHHHHHHHHHHccTTGGGccccccccccTTHHHHHHHHHccGGGHHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|104->116|reaeeffragear :=========================================== :RP:SCP|38->103|1d4cA1|3e-06|12.1|66/102|a.138.1.3 :============================================================:BL:SWS|1->251|UVRA_AQUAE|4e-54|47.4|247/926 121: . . + . . .: 180 :HAILTRLADVGLGYLSLGQPLTTLSGGERQRLKLATHMGDKGGIYVLDEPTTGLHLADVA:Sequence :TcHHHHHHHHHHHGGGTcccHHHccHHHHHHHHHHHHHHHcccEEEEETTTccccHHHHH:Sec Str : XXXXXXX:SEG|174->186|lhladvaqllall : ======================================================:RP:SCP|127->227|1f2t.1|2e-18|25.7|101/288|c.37.1.12 :============================================================:BL:SWS|1->251|UVRA_AQUAE|4e-54|47.4|247/926 181: . * . . . .: 240 :QLLALLDRIVDSGKSVIVIEHHQAVMAHADWIIDLGPGAGHEGGRVVFEGTPAELVAARS:Sequence :HHHHHHHHHcHTTcEEEEEcccGGGTTTccEEEEEHHTcEEETTEEEEEEcHHHHHHETT:Sec Str :XXXXXX :SEG|174->186|lhladvaqllall :=============================================== :RP:SCP|127->227|1f2t.1|2e-18|25.7|101/288|c.37.1.12 :============================================================:BL:SWS|1->251|UVRA_AQUAE|4e-54|47.4|247/926 241: + . . . . *: 300 :TLTGQHLADYVGA :Sequence :EEHTccHHHHHHH :Sec Str :=========== :BL:SWS|1->251|UVRA_AQUAE|4e-54|47.4|247/926