[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55595.1 tfus0 AAZ55595.1 "putative uvrA-like protein"
MVSIDQSAIRGSRRSNPATYTGLLDPIRKAFAKANGVKPSLFSANSEGACPACNGAGVIY
TDLAMMAGVATVCETCEGKRFQASVLKYTLGGRTISDVLEMSVREAEEFFRAGEARLPAA
HAILTRLADVGLGYLSLGQPLTTLSGGERQRLKLATHMGDKGGIYVLDEPTTGLHLADVA
QLLALLDRIVDSGKSVIVIEHHQAVMAHADWIIDLGPGAGHEGGRVVFEGTPAELVAARS
TLTGQHLADYVGA
//