[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55605.1"

            "arsenite efflux pump"
            ""

OrgPattern ------------------------------1--1---------------------------------- --------------------------------------------------1-------------------1---------------------------------------------------------------------------------------------------------------------------11111111-111111------111----------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPLAERLQSLFVALAALTGLATGLLLPIGPTAAHAVLPALILMLTAVFLQMNFARLGEAR:Sequence : XXXXXXXXXXXXXX :SEG|13->26|alaaltglatglll 61: . . . * . .: 120 :HATRLVTTSLILNFAVTPALAWTLGAGLLTTHPDLRIGLLLLLVTPCTDWYLVFTALAHG:Sequence : XXXXXXXXXXXXXXX :SEG|77->91|tpalawtlgaglltt 121: . . + . . .: 180 :HTGLATALLPVNLLLQLALLPGYVLLLGGNAAMVDATTLTESVLLVLALPLTTALGLRWI:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|123->150|glatallpvnlllqlallpgyvlllggn : XXXXXXXXXXXXXXXXXXXXXX :SEG|156->177|attltesvllvlalplttalgl 181: . * . . . .: 240 :ATRLKGAHWRHRFLTTPASRLVLPLLYAAVFAMFAGQARTVVTHAPDLIALLPPLAIFFT:Sequence : XXXXXXXXXXXXX:SEG|228->256|liallpplaifftalpatatatarilrlp 241: + . . . . *: 300 :ALPATATATARILRLPPDQRVTLVMTTTARNSPTALAIAVAAFPDRPLIAVALVIGPLLE:Sequence :XXXXXXXXXXXXXXXX :SEG|228->256|liallpplaifftalpatatatarilrlp 301: . . . . + .: 360 :IPVLTLLTQLVRIRPPHTTSSPR :Sequence