[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55679.1"

            "penicillin amidase"
            ""

OrgPattern 11----111111112---111--11------1-----------------------------121---- 11313----------------------------------------1------11------221-11-3231-----------1-------------1----11-41-121------------------------1-22221---21-12-11--------------1112-------------11-11------11111111-111111------111---12--------------------------------------------------------------------------------------------------------------------------------2---------------------3--111-------------------11121-1-11----1--1-1--1----------------111121111111------------1121------------------------------1-11-----1------12222---1333421---21221111-11--11-1113----------------111---1321--------------------11-1-2---------------------------11---1--1--1-1----1-1111-1-12-12---------------21-----------------1---1-----------------------------------11-----1-------------------1-------1-------------------11111-----1-33332233222221222------------------------1121311111--------111111-----------------------------------------------1- -------------------------------------------------------------------------------------------------------------6------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSVSVPRVRRWLLGILAAVLAVALITAGLAVWTVRRSFPQVSGELELPALSAPVTVYRDE:Sequence : ccccccccTccEEEEcT:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|12->31|llgilaavlavalitaglav : ==========:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 : ========================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 : $$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 61: . . . * . .: 120 :YGITHLYADTPEDLFTAQGYVHAQDRFWSMDFNRHVTAGRLAELFGADQVPTDAYLRTMG:Sequence :TccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHcGGGHHHHHHHHHTc:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 121: . . + . . .: 180 :WRRVAEAEYDLLAEETRRYLDAYAEGVNAYLEGKSATEVSLEYAVLAATNSEYEIEPWSA:Sequence :cHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHcHcHHHHccHHHHHHTcccccccH:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 181: . * . . . .: 240 :VDSLAWLKAMAWDLAGNMHDEIARASLLARGLPREQVEELYPAYPEEQHAPILAGGRVRD:Sequence :HHHHHHHHHTHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHcccccTTcccccccTT:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 241: + . . . . *: 300 :GKFVLDSDEAEQRDEDAADIPATAAVRALAGLQEPLEAIPRTFGPASSDLGSNSWVVSGE:Sequence :T ccccccccGGGcccGGGccccccccGGGGcccccTTcccHcEEEEEcGG:Sec Str : XXXXXXXXXXXXXX :SEG|246->259|dsdeaeqrdedaad :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 301: . . . . + .: 360 :HTASGLPLLANDPHLGAVMPSIWYQMGLHCTTVDESCPFDVTGFTFPGLTGVVIGANDTI:Sequence :GccccccEEEEEcEEEcccGGGEEEEEEEccccc EcccEEEEEEETTcccccEEEcccE:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 361: . . . * . .: 420 :AWGFTNLGPDVIDLYLEKLDGDSAIVDGAPEPLETRTETIRVAGGDDVEITVRSSRHGPL:Sequence :EEEEEccccccEEEEEccEETTEEEETTEEEcccccEEEEEEEcTTEEEEEccccccccE:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 421: . . + . . .: 480 :LSDPELGAQLRTFAAKAPVTPEGEPAETAQDGDYAVAISWTALTPGRTADAIFLLNRART:Sequence :EEEETT TTEEEEEETTTTEEEEEETTcTTccEEEEEETTTTcTTHHHHHHHHHTccc:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 481: . * . . . .: 540 :FDEFREAARTFEVPAQNLIYADTSGNIGYQAPGKIPVRGKGDGRWPAPGWDSDYDWKEYL:Sequence :HHHHHHHHTTccccccEEEEEETTccEEEEEccccccccccHHHccEEcccGGGcccccc:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 541: + . . . . *: 600 :PFEELPTVVNPDSGFIVTANQAVVDSGYPHLLTTDWDYGYRSQRVVTLLEAAIADGGLTV:Sequence :cGGGccEEEccTTcEEEEccccccGGGccTTccccccccHHHHHHHHHHHTc TcccccH:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 601: . . . . + .: 660 :EDMVDIQLDNENSGARALVPYLVEVDVEGAAAQAQELLAGWDFQQDADSAAAAFYNATYR:Sequence :HHHHHHHTccccHHHHHHHHHHHHHcccHHHHHHHHHHHTccccccTTcccHHHHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|628->640|egaaaqaqellag : XXXXXXXXXXXXX :SEG|642->654|dfqqdadsaaaaf :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 661: . . . * . .: 720 :HLLPLVFDELGANPKIEASQAWLLLTSLVESPESEWWRGEEVSSRDEALRVAMERAAAEL:Sequence :HHcTTTTcccTTEEEcccTTcTTEcccTTcccTTcTTTccEEEccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 721: . . + . . .: 780 :TELLGEDVAAWRWGDLHTLTVRNASFGESGIAAVEWLFNRGPVATGGGSSVVNATGWDPA:Sequence :HHHHcccGGcccHHHHcEEEETTEEEEEEccEEccccEcccccGGGTccccEEEccccTT:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :============================================================:BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 781: . * . . . .: 840 :QGYEVTTVPSMRMVVDLADVDNSQWINLTGNSGHAFHPHYADQLELWAAGTMLPMRMTRS:Sequence :ccccEEEEEcEEEEEEcccccEEEEEETTcccccTTcccccccHHHHHTTccEEccccHH:Sec Str :============================================================:RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :================================================== :BL:SWS|37->830|QUIP_PSEAE|3e-77|32.2|733/847 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase 841: + . . . . *: 900 :AVEEAAEHTLVLRP :Sequence :HHHHHccccccccc :Sec Str :============== :RP:SCP|51->854|1ai4.1|e-143|23.6|712/763|d.153.1.2 :$$$$$$ :RP:PFM|52->846|PF01804|e-146|51.0|716/733|Penicil_amidase