[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55697.1"

            "ABC-type Mn/Zn transport systems ATPase component"
            ""

OrgPattern RRHCNKFJNNLLLKOMjHQOJOOUrMQchWbRE7DDDBEDEDAQYMSgKN*vc9LcLSYOQGIEV187 MTnN*abfkklVbUVTSMM-Mg99Z*MMMMMPmqnss***U*U*s*phtjdPw*qPRaFGvu*l*o****aXTSSpWTXO*ahB5879TSNM5KEIB--CCPDEFTGTLL67777779B87777FPMFPPKDQNTMkmlyzHGGsbmdhqaacXbQSIEIEGHacaf*xuVHIEFECEKDFCEgXaQNWUAXgk********s*******zuusu***ajm*xemnqrpnn**WZZZbZWTXXZZZXXPSRUQndYYoqVOTRWnlKLoqSRMVcYXTXgfkgmgqqgglnljfgmmijjUUTTSUUTWSTSSthiVVZjikfc*m**xwxuvttYtZgqzzSbbW*hddk*bjRJ**ebXWYbQagWfeJOUbLZVRRLILKLMaU***ROk************z***-ho*ib*o***Q8**************GKM**********QQQQQQQQqXcKNjZ*556655551-4534544354343357575FA9CBB***********orrsp****zsvve*******x7Ksqi*hnfl*z****XelJSGKgUIHJHGHIMIJcngSv*TXWrhWhmcbfHaUXSOTaSUXZTWppXwAEEIC999ABA584555455BPBD9NMhkoMpQPGVGmOSVWTKQaTRSVTSVSXYX5-BIVLN12-222*r**U*uqzzyrzv*rr-xspsyuwtwuyzxpoqpoo*****dgbjkdhgiiijihgjghj*kgilmmoP3************34DFADABCLLJLMG*j*ZXYVSUFKNKIRLPbJKMLKDNJLRnZoqlns***p**tvd***CAA8A9A9ALcihuegffgqvppoLMMKILKHJJEEDE74MNJJCDEF66537536*CI76755-67648A666548A844557MdbOJdufggCXO ----UUE-QC69IRMD9E78HIEF8HJCC9A79DA9386767877766DFBDKBCBH6A98976655325555866626665547853-CF899694559559ILK7LcPTOWReUUD9A6ENFmj6nB**h2dOaHGC8YBCiN8GEDAVA9*ARNHiHd*EYGW5wVQ*VLWEAEGC*DBDGMxbh*B**IE*m**M -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS:Sequence : ======================================================:RP:SCP|7->228|1b0uA|2e-36|26.4|220/258|c.37.1.12 : ====================================================:BL:SWS|9->225|Y361_HAEIN|5e-63|51.6|217/306 : $$$$$$$$$$$$$$$:RP:PFM|46->168|PF00005|2e-14|39.5|119/123|ABC_tran 61: . . . * . .: 120 :GHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD:Sequence :============================================================:RP:SCP|7->228|1b0uA|2e-36|26.4|220/258|c.37.1.12 :============================================================:BL:SWS|9->225|Y361_HAEIN|5e-63|51.6|217/306 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->168|PF00005|2e-14|39.5|119/123|ABC_tran 121: . . + . . .: 180 :AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI:Sequence : ############### :PROS|142->156|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|7->228|1b0uA|2e-36|26.4|220/258|c.37.1.12 :============================================================:BL:SWS|9->225|Y361_HAEIN|5e-63|51.6|217/306 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|46->168|PF00005|2e-14|39.5|119/123|ABC_tran 181: . * . . . .: 240 :VRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPELMLRAFGLE:Sequence :================================================ :RP:SCP|7->228|1b0uA|2e-36|26.4|220/258|c.37.1.12 :============================================= :BL:SWS|9->225|Y361_HAEIN|5e-63|51.6|217/306 241: + . . . . *: 300 :EPA :Sequence