[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55755.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----1--------------------2----------1--1----111-----111---------1-11111--------------------------------------------------------------------11--------------------------------------------------------------------1------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------11111111111------1---1--111-112111231-----1-----1--11111111---------------------------------------------------1---------1----------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTSLTLRLPTPTGELETYTVLGTPVTPTRTTPARSRVAYAAAHVVADPLGSNGPGQPAQL:Sequence : cc:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|19->37|tvlgtpvtptrttparsrv : =:RP:SCP|60->334|1dhpA|1e-14|14.7|245/292|c.1.10.1 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->386|PF06187|e-114|58.8|381/382|DUF993 61: . . . * . .: 120 :DWDATLAFRHYLWDQGLGVADAMDTAQRGMGLDWAATAELIRRSAAEATARNAPLVCGVG:Sequence :cHHHHHHHHHHHHTTTccEEcTTcTTTTGGGccHHHHHHHHHHHHHHHHTTccEEEEEEc:Sec Str :============================================================:RP:SCP|60->334|1dhpA|1e-14|14.7|245/292|c.1.10.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->386|PF06187|e-114|58.8|381/382|DUF993 121: . . + . . .: 180 :TDHLEPSQATLESVIKAYREQLAVVQDAGATPVIMASRALAATAQSPDDYAKVYGQLLAD:Sequence :cccHHHcccHHHHHHHHHHHHHHHHHHHTccEEEEccccccccHHcHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|60->334|1dhpA|1e-14|14.7|245/292|c.1.10.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->386|PF06187|e-114|58.8|381/382|DUF993 181: . * . . . .: 240 :VDRPVILHWLGAVFDPALDGYWGYTDPAEAIDAVAALIADHADRVDGIKVSLLDDTLEVR:Sequence :HcccEEEEEccTTccTHHcEcHHHHcccccHHHHHHHHHTTcTTEEEEEEccccHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|206->223|dpaeaidavaaliadhad :============================================================:RP:SCP|60->334|1dhpA|1e-14|14.7|245/292|c.1.10.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->386|PF06187|e-114|58.8|381/382|DUF993 241: + . . . . *: 300 :LRTLLPDGVRLYTGDDFNYPDLILGDADGHSHALLGIFAAIAPAAAEALRALDDGDTDRY:Sequence :HHTTccGccEEEETcTTTHHHHHHHTccEEEEcGGGTcHHHHHHHHHHHHHHHTTcHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|273->292|allgifaaiapaaaealral :============================================================:RP:SCP|60->334|1dhpA|1e-14|14.7|245/292|c.1.10.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->386|PF06187|e-114|58.8|381/382|DUF993 301: . . . . + .: 360 :RALLAPTVPLSRHLFAAPTYYYKTGITFVAWLNGHQKGFSMVGGLQSARDLPHLATAFRL:Sequence :HHHHHHHHHHHHHHTTTTTTTTTHHHHHHHHHTTccccTTcc cccHHHHHHHHHH:Sec Str :================================== :RP:SCP|60->334|1dhpA|1e-14|14.7|245/292|c.1.10.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->386|PF06187|e-114|58.8|381/382|DUF993 361: . . . * . .: 420 :ADAAGVLTDPETAVSRMRTLLTVYGVDQ :Sequence :HHHTTcc :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->386|PF06187|e-114|58.8|381/382|DUF993