[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55755.1 tfus0 AAZ55755.1 "conserved hypothetical protein"
MTSLTLRLPTPTGELETYTVLGTPVTPTRTTPARSRVAYAAAHVVADPLGSNGPGQPAQL
DWDATLAFRHYLWDQGLGVADAMDTAQRGMGLDWAATAELIRRSAAEATARNAPLVCGVG
TDHLEPSQATLESVIKAYREQLAVVQDAGATPVIMASRALAATAQSPDDYAKVYGQLLAD
VDRPVILHWLGAVFDPALDGYWGYTDPAEAIDAVAALIADHADRVDGIKVSLLDDTLEVR
LRTLLPDGVRLYTGDDFNYPDLILGDADGHSHALLGIFAAIAPAAAEALRALDDGDTDRY
RALLAPTVPLSRHLFAAPTYYYKTGITFVAWLNGHQKGFSMVGGLQSARDLPHLATAFRL
ADAAGVLTDPETAVSRMRTLLTVYGVDQ
//