[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55822.1"

            "transcriptional regulator, GntR family"
            ""

OrgPattern -------------------------------------------------------------------- ----2-1-------1---------11-----------1221--2--1-----226-------2---322-1-----------1----------------------2---1-----------------------------------1-------------------------------------1-------------------------31111----1----------1-11---------------1------------------------------1111111---------1-----------1-----------1111-2--1------------11------------1-11------------------122--------1----------11111111112------1---3--1----131221111----11---11-1-------------1--------------------------------------1111------1----1133--------1-21--1-11-----1-3-21---------1111111---1---------1-----------------------1----------------------------------11------1---1111----1----------------------------------------------------------------------------1--------------------------------------------1---------------------1111-1--1-----121------------1------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGSESLADRLADRLLDQVVRGELAVDEALPSEAEIAAAADVSRLTVREAVKVLRTKNIVR:Sequence : HHHTTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEE:Sec Str : XXXXXXXXXXX :SEG|6->16|ladrladrlld : XXXXXXXXXXXXX :SEG|27->39|ealpseaeiaaaa : ============================================:RP:SCP|17->81|3bwgA1|5e-05|18.5|65/78|a.4.5.6 : ===================:BL:SWS|42->182|DGOR_ECOLI|1e-09|25.9|139/229 61: . . . * . .: 120 :VKRGRGTYVNAPEHWTDLELILRMAQRRSGAGAAALGLLEVRRILEAGAAELCAQRRSDA:Sequence :EETTEEEEEccHHHHccGGGHHHHHHHcTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXX :SEG|90->99|gagaaalgll :===================== :RP:SCP|17->81|3bwgA1|5e-05|18.5|65/78|a.4.5.6 : =====================:RP:SCP|100->229|2hs5A2|3e-16|14.8|128/138|a.78.1.1 :============================================================:BL:SWS|42->182|DGOR_ECOLI|1e-09|25.9|139/229 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|100->221|PF07729|2e-10|36.1|122/125|FCD 121: . . + . . .: 180 :DLALLTTHVAEMDKAIAADDASTFARAETAFHETIVRSCGNVFIPAICAPVDRLLLHLHA:Sequence :cHHHHHHHHHGGGTccTTccHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|100->229|2hs5A2|3e-16|14.8|128/138|a.78.1.1 :============================================================:BL:SWS|42->182|DGOR_ECOLI|1e-09|25.9|139/229 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|100->221|PF07729|2e-10|36.1|122/125|FCD 181: . * . . . .: 240 :RTATIAHIRVRAQSHHRRILSGIAAGSPAAARDAMRAHFDQLAEDLLRHVVDRCGVSEP :Sequence :HHTTcHHHHHHHHHHHHHHHHHHHHTcGGGHHHHHHHHHHHHHHHHHHHHHHH :Sec Str :================================================= :RP:SCP|100->229|2hs5A2|3e-16|14.8|128/138|a.78.1.1 :== :BL:SWS|42->182|DGOR_ECOLI|1e-09|25.9|139/229 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|100->221|PF07729|2e-10|36.1|122/125|FCD