[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55880.1"

            "ABC-type antimicrobial peptide transport system ATPase component"
            ""

OrgPattern XXMCQNLJXWWSWSbLjIQSOTRY*QUkoajXICDEDBHGGFDXdUXqNR**l9TcSXYNTJKFa19A VduS*hihssvXiTbYZRQ-QpBBc*RRRRRR*vux****Z*h****r*yoU***TUnCD***q*y****jgeee*hgeQ*irDBEACQSQL6NFJI--FFSJLJhNbQT89AAAA9BDCCCCCJWSOWbPPXYbWnvv**NMK*dxnrzifmfmVXVNPNRKfjar***cKSHKJIJTHLIJmbiTTwoCYgx********************z***io***jpxvwrqt**Zoppppljmnooommagdac*iYe**dPdWkwvTU**cWPZklkimtsvvvq*zz*uxstpouypttefeddfegggfde*onhggpnqio***********k*nq***alli*rkwy*isTO***mYgjoTclcqjPfblNeXWWNMPMLOeb***eWw****************-z**wo*y***XC**************KMP**********ZYZZZZZZ*hnLWrc*7766655577578ABC9ABA8A99A96B7KFGMFG************************u********CO**s*r*rz******fusOZLWqYJKJJKIIUQTdumf**UgZ*uatwhftLgYcXXckXcfdefy*c*JMQSHOONPNJCEDFEEFCEIWGGJVUvtzUzWiMYQ*RaadZPYhYVVaWYcbbgc5-FLaRP321333****b**********z*-**z**********wxzxwx*****rrlrtnqqtsrsspqsqqp*vptwwuyX3************33JIDGDDENOQOOL*u*ZZYZabMRUPOXQWgPRTSRITIPW*i*************p***GFFDEGFEFLksq*xxyyx*****UUSNPONNPNFEEE77OWRQJKLMA9798999*CWEACDC-FFDFIEEQQNBENEHGAAAamxYYs*trrEhQ 3322qjK-eJAATfXOIOHPTcVZYZRKKGKGLUQOISPPLQQIHGOLQcXVoeRRTHJKLLEAD69A2CD7GBGAB2CBEHEEJH48-JQCIEFMCCBDEAHRTP6WvszcfZqelNJLHKXPxsC*F**q3vVrLMGEjGLmbHQJHBdCB*HcVQzOu*OyRkI*el*cmpKIPKM*JMLQX****J**PQ****j -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPTPPAPSGTAEPHAVVVQGLTKVYPTGGEPVRALDGVDVSFARGAFTAIMGPSGSGKST:Sequence : =============================================:RP:SCP|16->229|1sgwA|3e-42|19.9|196/200|c.37.1.12 : ===========================================:BL:SWS|18->234|MACB_BDEBA|3e-52|44.4|216/650 : $$:RP:PFM|59->181|PF00005|2e-19|47.4|116/123|ABC_tran 61: . . . * . .: 120 :LMHCMAGLDTPTSGSVRLGATELTALSDKQLTLLRRDRIGFVFQSFNLLPMLTARQNILL:Sequence :============================================================:RP:SCP|16->229|1sgwA|3e-42|19.9|196/200|c.37.1.12 :============================================================:BL:SWS|18->234|MACB_BDEBA|3e-52|44.4|216/650 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|59->181|PF00005|2e-19|47.4|116/123|ABC_tran 121: . . + . . .: 180 :PSQISKRKVDPERFRHIVEVTGLADRLEHLPAKLSGGQQQRVAVARALVGSPEVLYADEP:Sequence : ############### :PROS|154->168|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|16->229|1sgwA|3e-42|19.9|196/200|c.37.1.12 :============================================================:BL:SWS|18->234|MACB_BDEBA|3e-52|44.4|216/650 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|59->181|PF00005|2e-19|47.4|116/123|ABC_tran 181: . * . . . .: 240 :TGNLDSRSGAEVLSFLRDSVRELGQTIVMVTHDPIAASYADRVVFLRDGRVVDDVTHPTP:Sequence :================================================= :RP:SCP|16->229|1sgwA|3e-42|19.9|196/200|c.37.1.12 :====================================================== :BL:SWS|18->234|MACB_BDEBA|3e-52|44.4|216/650 :$ :RP:PFM|59->181|PF00005|2e-19|47.4|116/123|ABC_tran 241: + . . . . *: 300 :QLILDRLAGLEG :Sequence