[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55880.1 tfus0 AAZ55880.1 "ABC-type antimicrobial peptide transport system ATPase component"
MPTPPAPSGTAEPHAVVVQGLTKVYPTGGEPVRALDGVDVSFARGAFTAIMGPSGSGKST
LMHCMAGLDTPTSGSVRLGATELTALSDKQLTLLRRDRIGFVFQSFNLLPMLTARQNILL
PSQISKRKVDPERFRHIVEVTGLADRLEHLPAKLSGGQQQRVAVARALVGSPEVLYADEP
TGNLDSRSGAEVLSFLRDSVRELGQTIVMVTHDPIAASYADRVVFLRDGRVVDDVTHPTP
QLILDRLAGLEG
//