[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55924.1"

            "glycogen debranching enzyme GlgX"
            ""

OrgPattern -------222222222------------------------------1---11---------------- 234--13222213-13422-23--2322222233332333433333421432334313---1424--46314333222----2-1---2221---1---211-113-431111111111111112---------1-55511---21-2724421111-12112-2-22253212111111111422------1-222221221222222-222-2222-11-134--------1--------------------1--11---------1----------222222221122222222222111111111111133211-33313--12-------2-1--1112322--21-13------1-21-1---3-1-1-4----------223322234333------------34433333322-1223434433332-1---2244441--33333333222-3235-------------------------------1----2223222-22422223334222221223322---2231-3---1-34---213-2---------113331111--21-111111-423-111-223325514-----------------------11113234-32-2-421122-1-111111-21-----31-2------13221111111111111-11111111111111111112222211-333333333333333211111111--222222222222-------------2-1-2222111-11111111----------32333333334333233331111111111122323232333222-33333333------1---------------1-2----------1-----2---1----122221211125- ----1------1--3-1-11--1----------111-111111-----11----11--1---1---------1--------11111---1211111111----111--------------------------------------------------1------1----------14365n444344647174------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPMVEVWPGHAYPLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWH:Sequence : HHHHccccccEEEEcccEEEEEEEcTTccEEEEEEEcTTcccEEEEcEEcGGGEEE:Sec Str : =============================:RP:SCP|32->82|2qlvB1|2e-04|11.8|51/87|b.1.18.21 : ===:RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 : =======================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->98|PF02922|4e-07|51.3|76/82|CBM_48 61: . . . * . .: 120 :GYLPTVGPGQRYGYRVHGPYDPERGLRCNPNKLLVDPYAKAIDGQIHWHESLFDYHFADP:Sequence :EEEEcccTTcEEEEEEEETEEcccTTccTEEEEEccTTcccccGGGccEccccGGGGccc:Sec Str :====================== :RP:SCP|32->82|2qlvB1|2e-04|11.8|51/87|b.1.18.21 :============================================================:RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|14->98|PF02922|4e-07|51.3|76/82|CBM_48 121: . . + . . .: 180 :GRVNNHDSAPYVPTCVVVSPFFDWGAEQHPNIPYHETVIYEAHVRGMTIRHPDVPPPLRG:Sequence :TTTTTcccTTTcccEccccccccccccccccccGGGccEEEEcHHHHHHcTTcccccTTc:Sec Str :============================================================:RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 181: . * . . . .: 240 :TYAGMAHPAIIEHLLSLGVTAVELMPIHHFLPEHALVARGLTNYWGYNTLAFFAPHSGYA:Sequence :GGGGGcTTcHHHHHHHHTccEEEEcccEEEcccccTTcGGGcccccccEEEEEEEccTTc:Sec Str :============================================================:RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|191->529|PF00128|1e-26|45.4|260/296|Alpha-amylase 241: + . . . . *: 300 :ATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDHMGPALSLRGIDNLAYYRVRE:Sequence :ccccHHHHHHHHHHHHHHHHHTTcEEEEEEcTTccccGGGcHHHHHcTTTcccccccHcc:Sec Str :============================================================:RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|191->529|PF00128|1e-26|45.4|260/296|Alpha-amylase 301: . . . . + .: 360 :DNPRYYLDYTGCGNSLNVRHPHSLQLIMDSLRYWVLDMHVDGFRFDLAAALAREFHDVDR:Sequence :cTTcccccTTcccccccTTcHHHHHHHHHHHHHHHHHHcccEEEETTGGGccHHHHHHHH:Sec Str :============================================================:RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|191->529|PF00128|1e-26|45.4|260/296|Alpha-amylase 361: . . . * . .: 420 :LSTFFDIVQQDPVISQVKLIAEPWDVGPGGYQVGNFPPLWTEWNGKYRDTVRDFWRGYPV:Sequence :HHHHHHcTTcEEEEccccccccccGGGcccGGGGGGcTTcEEEcHHHHHHHHcccccTTc:Sec Str :============================================================:RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|191->529|PF00128|1e-26|45.4|260/296|Alpha-amylase 421: . . + . . .: 480 :LPELASRISGSSDLYQADGRRPVASINFVTCHDGFTLADLVSYDRKHNEANGEDNRDGTD:Sequence :HTcccGGGTcGGGHHHHHHHHcTTcccTTcccccccGGGEEEcccccccccHHHHHHHHc:Sec Str :============================================================:RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|191->529|PF00128|1e-26|45.4|260/296|Alpha-amylase 481: . * . . . .: 540 :DNRSWNHGTEGPTTDSAIATLRRRQMRNMLTTLMLSQGVPMLSHGDEIGRTQHGNNNAYC:Sequence :TTccHHcccEEEEccEEEEEHHHHHHHHHHHHHHTcccEEEEETTGGGTcccTTccccTT:Sec Str :============================================================:RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|191->529|PF00128|1e-26|45.4|260/296|Alpha-amylase 541: + . . . . *: 600 :QDNPISWVDWELARRNADLLDFVRTLSRLRREHPVFRRRRFFQGALPGRGKQRDIAWLRP:Sequence :ccHHHHcccHHHHHHTHHHHHHHHHHHHHHHHcGGGcccccccTHHHHHHHHcGGGGccc:Sec Str : XXXXXXXXXXXXXXX :SEG|568->582|rlrrehpvfrrrrff :=============== :RP:SCP|58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1 : ========:RP:SCP|593->700|1bf2A2|6e-11|26.3|99/113|b.71.1.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 601: . . . . + .: 660 :DGTLMEDADWGRGWRALGVFLNGDAITEPDRMGRRIRDDSFLLLLNAGINDVQFTLPGPS:Sequence :HHHHHHHEEEEEEcccEEEEEEccGGGTEcEcTTTccccEEEEEEEccccEEEEEccccc:Sec Str :============================================================:RP:SCP|593->700|1bf2A2|6e-11|26.3|99/113|b.71.1.1 :============================================================:BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721 661: . . . * . .: 720 :YSAAWETVVDTADPEVAGRPYLPAGSDVTVIDRSFLVLKGVTKALPS :Sequence :ccccEEEEEETTEEEEEEEcccEEccEEEEEccEEEEEE :Sec Str :======================================== :RP:SCP|593->700|1bf2A2|6e-11|26.3|99/113|b.71.1.1 :======================================= :BL:SWS|6->699|GLGX_MYCTU|0.0|63.7|694/721