[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55924.1 tfus0 AAZ55924.1 "glycogen debranching enzyme GlgX"
MPMVEVWPGHAYPLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWH
GYLPTVGPGQRYGYRVHGPYDPERGLRCNPNKLLVDPYAKAIDGQIHWHESLFDYHFADP
GRVNNHDSAPYVPTCVVVSPFFDWGAEQHPNIPYHETVIYEAHVRGMTIRHPDVPPPLRG
TYAGMAHPAIIEHLLSLGVTAVELMPIHHFLPEHALVARGLTNYWGYNTLAFFAPHSGYA
ATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDHMGPALSLRGIDNLAYYRVRE
DNPRYYLDYTGCGNSLNVRHPHSLQLIMDSLRYWVLDMHVDGFRFDLAAALAREFHDVDR
LSTFFDIVQQDPVISQVKLIAEPWDVGPGGYQVGNFPPLWTEWNGKYRDTVRDFWRGYPV
LPELASRISGSSDLYQADGRRPVASINFVTCHDGFTLADLVSYDRKHNEANGEDNRDGTD
DNRSWNHGTEGPTTDSAIATLRRRQMRNMLTTLMLSQGVPMLSHGDEIGRTQHGNNNAYC
QDNPISWVDWELARRNADLLDFVRTLSRLRREHPVFRRRRFFQGALPGRGKQRDIAWLRP
DGTLMEDADWGRGWRALGVFLNGDAITEPDRMGRRIRDDSFLLLLNAGINDVQFTLPGPS
YSAAWETVVDTADPEVAGRPYLPAGSDVTVIDRSFLVLKGVTKALPS
//