[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55977.1"

            "putative secreted protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------1----------1--------1-------1--3221---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-111---------11--111111111111-----------------------------------------------------------------------------------------------------------------------------------------1----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGKISRRTFLSATALTALGTVGCSTTQAGTGPEAAPRRVRVIGDGSTSDTGPQPNQPTVD:Sequence : cGGGTcccccEEEEEEEEccccccG GGHHHHH:Sec Str : ============:RP:SCP|49->368|1z7aA1|1e-14|15.1|258/301|c.6.2.6 61: . . . * . .: 120 :QLDRRSGPPQFVVVSWDGAGELSDRLFSRFREVARRNNAHMTFFLSGIYLLPEHRKHLYH:Sequence :HHHHHccccEEEEEEEEcccHHccTTHHHHHHHHHHTTcccEEEEcHHHHHHH HHHHH:Sec Str :============================================================:RP:SCP|49->368|1z7aA1|1e-14|15.1|258/301|c.6.2.6 121: . . + . . .: 180 :PPKHPVGASDIGYLSEESIHRTIRQLDLAWREGHEIGTHFNGHFCGPNGVSTWSPADWES:Sequence :HHHHHTTcccEEEEcGGGHHHcHHHHHHHHHTTcEEEEccccccccTT ccHHHHHH:Sec Str :============================================================:RP:SCP|49->368|1z7aA1|1e-14|15.1|258/301|c.6.2.6 181: . * . . . .: 240 :EIQQAIKFVMTWKTNTGFTDLPPLPFDYRKELVGGRTPCLQGRDQLLPTAAKLGWRYDAS:Sequence :HHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEEccccccTTHHHHHHHHccccEEccc:Sec Str :============================================================:RP:SCP|49->368|1z7aA1|1e-14|15.1|258/301|c.6.2.6 241: + . . . . *: 300 :SPGWLQVWPVRRHGLWDFPLQSLPMAGEDFEVLSMDYNIMVNQSKTPQGDRSKYGRWRAQ:Sequence :ccccccEEccccTTccccHHG GGTTccEEcHEEccccccccGGGGGcccccccHHHHHH:Sec Str :============================================================:RP:SCP|49->368|1z7aA1|1e-14|15.1|258/301|c.6.2.6 301: . . . . + .: 360 :ARDTYLKGFERAYFSNRAPLFIGNHFQRWNGGIYMDAVEQFMDEIGGEPDVRMVSFRQLA:Sequence :HHHHHHHHHHHHTTTccEEEEEEEEHHHHTcHHHHHHHHHHHHHHHTcccEEEccHHHHH:Sec Str :============================================================:RP:SCP|49->368|1z7aA1|1e-14|15.1|258/301|c.6.2.6 361: . . . * . .: 420 :DWLDAQDPGVLTKLARLNVGQAPPGGWEEYLNSDAPLP :Sequence :HHHHHHcc :Sec Str :======== :RP:SCP|49->368|1z7aA1|1e-14|15.1|258/301|c.6.2.6