[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ55977.1 tfus0 AAZ55977.1 "putative secreted protein"
MGKISRRTFLSATALTALGTVGCSTTQAGTGPEAAPRRVRVIGDGSTSDTGPQPNQPTVD
QLDRRSGPPQFVVVSWDGAGELSDRLFSRFREVARRNNAHMTFFLSGIYLLPEHRKHLYH
PPKHPVGASDIGYLSEESIHRTIRQLDLAWREGHEIGTHFNGHFCGPNGVSTWSPADWES
EIQQAIKFVMTWKTNTGFTDLPPLPFDYRKELVGGRTPCLQGRDQLLPTAAKLGWRYDAS
SPGWLQVWPVRRHGLWDFPLQSLPMAGEDFEVLSMDYNIMVNQSKTPQGDRSKYGRWRAQ
ARDTYLKGFERAYFSNRAPLFIGNHFQRWNGGIYMDAVEQFMDEIGGEPDVRMVSFRQLA
DWLDAQDPGVLTKLARLNVGQAPPGGWEEYLNSDAPLP
//