[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ55991.1"

            "conserved hypothetical protein"
            ""

OrgPattern ---------------------------1---1-------------111--1111-1-1-1--1----- ---------------11-------------------------------------------11----1-111-------------------------------------------------------1-----------------------------------------------------------------1-----------------1-------111-------------------------------------------------------------------------------------------------------------------------------------1---1-1-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDTETIGDGTLLTAHLRWRRDNGRALAAVLWQCGPGWRMAASSVLGGGLGPRDYVINAQV:Sequence : cccEEEEEEEEccGG GGTTTccccccHHHHHHHHH:Sec Str : =====================:BL:SWS|40->189|CBIZ_METMA|6e-16|36.8|136/100 : $$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->190|PF01955|4e-17|47.6|147/193|CbiZ 61: . . . * . .: 120 :DGDYRRTDPDNHLEELATHFGMTGTGVGLLTAANVSEACFADDHGVEVLATVGLGRPTWA:Sequence :HHHHHTTcccccccEEEcTTccEEEcccTTccccccTTccTTEEEEEEccccccccccHH:Sec Str :============================================================:BL:SWS|40->189|CBIZ_METMA|6e-16|36.8|136/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->190|PF01955|4e-17|47.6|147/193|CbiZ 121: . . + . . .: 180 :AADPALDEARLPGEETRPGTINIVVAVPAPMSDTALVNLVATATEAKVQALFDSGYACTG:Sequence :HHH :Sec Str :============================================================:BL:SWS|40->189|CBIZ_METMA|6e-16|36.8|136/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->190|PF01955|4e-17|47.6|147/193|CbiZ 181: . * . . . .: 240 :TASDAVCVAALVGDTPPAQRELFGGVRSRWGGRVARAVYAAVAEGARREAARSQQRSPHR:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|211->232|ggrvaravyaavaegarreaar :========= :BL:SWS|40->189|CBIZ_METMA|6e-16|36.8|136/100 :$$$$$$$$$$ :RP:PFM|38->190|PF01955|4e-17|47.6|147/193|CbiZ 241: + . . . . *: 300 :AAAYSPSMMSGT :Sequence : :Sec Str