[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56010.1"

            "EAL domain"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------1-211-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1----------------------------------------------------------1-1-------------------------------------1-1----1------------------------------------11--111111-----1111------1111-11--22------1------------1-----------1-------111-----2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111111----1111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQGRSGDHGAVSPQTSFSDDTRVGVLPTASLSVVLRPIIDLDSGAVLAVEAVVPVDRRSG:Sequence : EEEEEEEEEEcccccEEEEEEEEcccccHH:Sec Str : ========================:RP:SCP|37->231|2basA1|1e-12|17.8|191/257|c.1.33.1 : =========================================================:BL:SWS|4->227|PHY2_SYNY3|7e-09|28.8|222/1276 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->231|PF00563|1e-07|26.8|205/236|EAL 61: . . . * . .: 120 :ADVAVLTELLGRVARETAARESFLPLVLPFPARLLTAGQEPLGFLRDTLQRSGRQPRDVT:Sequence :HHHHHHHHHHHHHHHHHTTccTTcEEEEccHHHHGcGTTHHHHHHHHHHHHTTccGGGEE:Sec Str :============================================================:RP:SCP|37->231|2basA1|1e-12|17.8|191/257|c.1.33.1 :============================================================:BL:SWS|4->227|PHY2_SYNY3|7e-09|28.8|222/1276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->231|PF00563|1e-07|26.8|205/236|EAL 121: . . + . . .: 180 :LMVDADLCFLPRDHLVAALARVREMGFRYAFDTARVSPDLLVETAPFLFRIEGSLTSGLP:Sequence :EEEEccTTccccHHHHHHHHHHHTTTcEEEEETTcccHHHHHHHcccEEEEEcTTTcccH:Sec Str :============================================================:RP:SCP|37->231|2basA1|1e-12|17.8|191/257|c.1.33.1 :============================================================:BL:SWS|4->227|PHY2_SYNY3|7e-09|28.8|222/1276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->231|PF00563|1e-07|26.8|205/236|EAL 181: . * . . . .: 240 :DQEQCAAIVDGMTRIARGAGTFPLASGVTSIAQLTALRTVGVRMAQGPLFAGDDWAPGDR:Sequence :HHTTHHHHHHHHHHHHHHHTcEEEEEccccHHHHHHHHHTTEEEEccTTTcccccccccH:Sec Str :=================================================== :RP:SCP|37->231|2basA1|1e-12|17.8|191/257|c.1.33.1 :=============================================== :BL:SWS|4->227|PHY2_SYNY3|7e-09|28.8|222/1276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|26->231|PF00563|1e-07|26.8|205/236|EAL 241: + . . . . *: 300 :VTQIPALSLEPLAPDSGAGLRVSEFMVPAVTMTVEATSEEVLEAFSADSALNSVILLDHR:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHTGGGccEEEEETT:Sec Str 301: . . . . + .: 360 :ERPVAALDRARFLLSITGPYGHALYAKRPAQKLADPPRTVPLTAPALAALRIAGTDQDRV:Sequence :ccccccHHHHHHHTTcccTHHHHH HccTHHHHH :Sec Str : XXXXXXXXXXXXXXXX :SEG|336->351|pprtvpltapalaalr 361: . . . * . .: 420 :YDDLIAVNEFGQCRGVVHISDIIRGLSAR :Sequence : :Sec Str