[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ56010.1 tfus0 AAZ56010.1 "EAL domain"
MQGRSGDHGAVSPQTSFSDDTRVGVLPTASLSVVLRPIIDLDSGAVLAVEAVVPVDRRSG
ADVAVLTELLGRVARETAARESFLPLVLPFPARLLTAGQEPLGFLRDTLQRSGRQPRDVT
LMVDADLCFLPRDHLVAALARVREMGFRYAFDTARVSPDLLVETAPFLFRIEGSLTSGLP
DQEQCAAIVDGMTRIARGAGTFPLASGVTSIAQLTALRTVGVRMAQGPLFAGDDWAPGDR
VTQIPALSLEPLAPDSGAGLRVSEFMVPAVTMTVEATSEEVLEAFSADSALNSVILLDHR
ERPVAALDRARFLLSITGPYGHALYAKRPAQKLADPPRTVPLTAPALAALRIAGTDQDRV
YDDLIAVNEFGQCRGVVHISDIIRGLSAR
//