[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56050.1"

            "glyceraldehyde-3-phosphate dehydrogenase"
            ""

OrgPattern ----------------1-------1--1111------------1--------------------1--- 1111222222221211111-111111111111111111221121121211112222221111211212321111111111111111111111111111111333322113111111111111111111111111112223311121222322233332222322222332322222122122111111111122222222222222222222222222222222211111124222222222222222222222111121111111-1111111112221111111112111111111111111111111111111111111112311222222212112221111211112113333222112111111111121111111111111121111112111111111111-1111111111111111111111111211143233223441111111111111111111111111111-------------111111111111111111111111111111111111111223211111131111212111121112212222222121223114332222222222232221432111111132111111111122222222212223113323314344446444444544444445441-1131211111143322322333233333-332333332333333233344322222232223222322222233323233112222222222221111111111111135441111111111111112222222222313333333353334433311111111123334444444444411111111111111113111111111111111111111-1-1111121111111112---1111111111111 1111111-53421121111233432321111111111111111111211211111111111113113221222135333411111162-111121922211112341162227224222112B1V*2H2Bw2-32N1222X22A3-21214--A23122--22211251-744313345*33343G7PB175655A653 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEV:Sequence :cccEEEEEcccHHHHHHHHHHHHcccHTccEEEEEccccHHHHHHHHHccTTTccccccE:Sec Str : ===========================================================:RP:SCP|2->181|1a7kA1|2e-41|42.0|169/189|c.2.1.3 :============================================================:BL:SWS|1->335|G3P_STRCO|e-138|73.1|334/336 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->154|PF00044|2e-46|60.8|148/148|Gp_dh_N 61: . . . * . .: 120 :EVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVI:Sequence :EEcccEEEETTEEEEEEccccGGGccHHHHTEEEEEEcccccccHHHHHTTGGGTccEEE:Sec Str :============================================================:RP:SCP|2->181|1a7kA1|2e-41|42.0|169/189|c.2.1.3 :============================================================:BL:SWS|1->335|G3P_STRCO|e-138|73.1|334/336 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->154|PF00044|2e-46|60.8|148/148|Gp_dh_N 121: . . + . . .: 180 :ISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTV:Sequence :EccccccccEEccTTTcGGGccTTTccEEEcccHHHHHHHHHHHHHHHHTcEEEEEEEEE:Sec Str :============================================================:RP:SCP|2->181|1a7kA1|2e-41|42.0|169/189|c.2.1.3 : ===========================:RP:SCP|154->315|1a7kA2|9e-38|45.1|162/169|d.81.1.1 :============================================================:BL:SWS|1->335|G3P_STRCO|e-138|73.1|334/336 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->154|PF00044|2e-46|60.8|148/148|Gp_dh_N : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|159->313|PF02800|2e-41|56.1|155/156|Gp_dh_C 181: . * . . . .: 240 :HAYTNDQVILDYPHKDLRRARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPD:Sequence :EEccTTccccccccccTTTTccTTcccEEEcccHHHHHTTTcGGGTTcEEEEEEEEcccc:Sec Str := :RP:SCP|2->181|1a7kA1|2e-41|42.0|169/189|c.2.1.3 :============================================================:RP:SCP|154->315|1a7kA2|9e-38|45.1|162/169|d.81.1.1 :============================================================:BL:SWS|1->335|G3P_STRCO|e-138|73.1|334/336 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|159->313|PF02800|2e-41|56.1|155/156|Gp_dh_C 241: + . . . . *: 300 :GSVTDLVVTLEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDASL:Sequence :cEEEEEEEEEcccccHHHHHHHHHHHHTTTTTTTEEEEcccccHHHHTTccccEEEEGGG:Sec Str : XXXXXXXXXXXXXXXXX :SEG|256->272|keevnaafkaaaegalk :============================================================:RP:SCP|154->315|1a7kA2|9e-38|45.1|162/169|d.81.1.1 :============================================================:BL:SWS|1->335|G3P_STRCO|e-138|73.1|334/336 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|159->313|PF02800|2e-41|56.1|155/156|Gp_dh_C 301: . . . . + .: 360 :TMAFGTQVKVVGWYDNEWGYSNRLVDLVKLVGSNL :Sequence :cEEETTEEEEEEEEcTTHHHHHHHHHHHHHHHHTc :Sec Str :=============== :RP:SCP|154->315|1a7kA2|9e-38|45.1|162/169|d.81.1.1 :=================================== :BL:SWS|1->335|G3P_STRCO|e-138|73.1|334/336 :$$$$$$$$$$$$$ :RP:PFM|159->313|PF02800|2e-41|56.1|155/156|Gp_dh_C