[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56054.1"

            "Excinuclease ABC subunit C"
UVRC_THEFY  "RecName: Full=UvrABC system protein C;         Short=Protein uvrC;AltName: Full=Excinuclease ABC subunit C;"

OrgPattern ------------------------11111111111---1111111111-1111-------------11 1121111111111122222-22112222222111112222222223121111111111112222212111211111111111211111111111112--1111222112111111111111111111111111121111111111211111111111111111111211111111111111111111111111111111111111111111111111111111112222221111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111222222222212111221111211111111122111111111111111212111111111111111111111111111111111-111111111111111111111111111111111111-111111111111111111111---------1122111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111121111111111111111111111111112111111111111111111111111111111111111111111111111111111111111--11111------11111112222222222-2222222222222222221111111111111211212111111122222221-111111111111--11111111111111111111111111-111111111111111111111111111111111111111111111111111111211111111111111111-111111111111111111111--1-11111111111111111111111111111111 ------------------------------------------------------------------------------------------------------------2-------------------------------------------------------------3--1-1---------1--1-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTM:Sequence :cEEcccccEEEcccccccccEEEEcTTccEEEEEEEEccccccEEccccccccTcccccE:Sec Str : ===========================================:RP:SCP|18->100|1ln0A|6e-21|19.3|83/92|d.226.1.1 :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->94|PF01541|2e-07|38.7|75/80|GIY-YIG 61: . . . * . .: 120 :ISTAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVM:Sequence :EEEcccccHEEEEccccccccEEEcccTTTTccccccccccEE EEEEEEcccccEE:Sec Str :======================================== :RP:SCP|18->100|1ln0A|6e-21|19.3|83/92|d.226.1.1 :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|18->94|PF01541|2e-07|38.7|75/80|GIY-YIG 121: . . + . . .: 180 :RGARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCS:Sequence :ccTT ccEEEGGGccHHHHT TTTTHHHHGGGcccc cccccccccccTTcc :Sec Str :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 181: . * . . . .: 240 :APCVGRIGVEEYRALAEDFCAFMAGETGRFLRQLEAEMKQAAAAQEYERAARIRDDIQAL:Sequence : EcccHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|213->232|qleaemkqaaaaqeyeraar : ========:RP:SCP|233->305|1oeyJ|5e-13|11.6|69/105|d.15.2.2 :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 241: + . . . . *: 300 :RTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL:Sequence :HHHHHHHcccccccccccEEEEEHHHHHHHHHHHHHTTccTTcEEEEEEcccccHHH :Sec Str :============================================================:RP:SCP|233->305|1oeyJ|5e-13|11.6|69/105|d.15.2.2 :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 301: . . . . + .: 360 :VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR:Sequence :HHHHHHHHHH HcccEEEEEEccccHHHHHHHHHHHH TTccEEEEEGGGccTT:Sec Str :===== :RP:SCP|233->305|1oeyJ|5e-13|11.6|69/105|d.15.2.2 :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 361: . . . * . .: 420 :ALMETVLKNAEQTLARHKSQRASDLTTRSKALAEIAEALGLAEAPLRIECFDISTLQGEH:Sequence :THHHHHHHHHHHHHHHTTccccEEcccTTccT HHHHcccHHHHccEEEEEEEEEccccE:Sec Str : XXXXXXXXXXXXXX :SEG|391->404|alaeiaealglaea :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 : $$$$$$$$$$$$$$$$:RP:PFM|405->572|PF08459|7e-47|66.2|142/156|UvrC_HhH_N 421: . . + . . .: 480 :TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL:Sequence :EEEEEEEEcTTccEEEEEEcccEEGGGHHHHHHHHHHHHHHHHHHHTcTTTccEHHEEEE:Sec Str : ================================================:RP:SCP|433->567|1xkpB1|4e-23|10.6|104/121|d.198.1.1 :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|405->572|PF08459|7e-47|66.2|142/156|UvrC_HhH_N 481: . * . . . .: 540 :GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVW:Sequence :EHHHEEEEEHHccHHTccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHTTcEEEEE:Sec Str :============================================================:RP:SCP|433->567|1xkpB1|4e-23|10.6|104/121|d.198.1.1 :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|405->572|PF08459|7e-47|66.2|142/156|UvrC_HhH_N 541: + . . . . *: 600 :LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA:Sequence :EEEEcccEEEccccEEEccccEEEEEEEccccEEEEEEEEEEEEEcccTTTHHHHHHHHH:Sec Str :=========================== :RP:SCP|433->567|1xkpB1|4e-23|10.6|104/121|d.198.1.1 : ============================================:RP:SCP|557->643|2oceA1|5e-16|17.6|85/90|a.60.2.6 :============================================================:BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|405->572|PF08459|7e-47|66.2|142/156|UvrC_HhH_N 601: . . . . + .: 660 :ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENSKADE :Sequence :HHHHHHTTcHcTTccccccccHHHHHHHHHHHHHHHHHcGGGHHHHccHH :Sec Str :=========================================== :RP:SCP|557->643|2oceA1|5e-16|17.6|85/90|a.60.2.6 :======================================================== :BL:SWS|1->656|UVRC_THEFY|0.0|100.0|656/656