[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ56054.1 tfus0 AAZ56054.1 "Excinuclease ABC subunit C"
MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTM
ISTAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVM
RGARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCS
APCVGRIGVEEYRALAEDFCAFMAGETGRFLRQLEAEMKQAAAAQEYERAARIRDDIQAL
RTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL
VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR
ALMETVLKNAEQTLARHKSQRASDLTTRSKALAEIAEALGLAEAPLRIECFDISTLQGEH
TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL
GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVW
LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA
ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENSKADE
//