[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56082.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----9----------1111-11--1111111111116112-5462---1-----------64--575CBA6---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNASENLNWLLDDLVDRVVGADHAIVLSADGLLIGRSRGLTDEEGEHLSAVASAFQSLA:Sequence : HHHHHTccccTTcEEEEEETTccEEEEcTTcccccHHHHHHHHHHHHcTT:Sec Str : ==================================================:RP:SCP|11->126|1a0kA|1e-19|18.1|116/130|d.110.1.1 : =====================:BL:SWS|40->121|MNME_CHLCH|3e-04|25.3|79/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->98|PF03259|8e-11|44.0|84/90|Robl_LC7 61: . . . * . .: 120 :RGTSRQFKGGRVLQTVVEMEHAYLFVTAAGEGACMAVLAAEDADVGMIAYEMNSRIKRVG:Sequence :ccTTTcEEETTEEEEEEEEETTTEEEEEETTEEEEEEEEEEEEETTccHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|11->126|1a0kA|1e-19|18.1|116/130|d.110.1.1 :============================================================:BL:SWS|40->121|MNME_CHLCH|3e-04|25.3|79/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|14->98|PF03259|8e-11|44.0|84/90|Robl_LC7 121: . . + . . .: 180 :QFLTSAPRHPEAAGRVSTGS :Sequence :HHHHHT :Sec Str :====== :RP:SCP|11->126|1a0kA|1e-19|18.1|116/130|d.110.1.1 := :BL:SWS|40->121|MNME_CHLCH|3e-04|25.3|79/100