[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ56082.1 tfus0 AAZ56082.1 "conserved hypothetical protein"
MSNASENLNWLLDDLVDRVVGADHAIVLSADGLLIGRSRGLTDEEGEHLSAVASAFQSLA
RGTSRQFKGGRVLQTVVEMEHAYLFVTAAGEGACMAVLAAEDADVGMIAYEMNSRIKRVG
QFLTSAPRHPEAAGRVSTGS
//