[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56085.1"

            "argininosuccinate synthase"
ASSY_THEFY  "RecName: Full=Argininosuccinate synthase;         EC=6.3.4.5;AltName: Full=Citrulline--aspartate ligase;"

OrgPattern ---1-11111111111-1111111111111111111111111111111111111-1-----1111-11 1111111111111111111-11111111111111111111111111111111111111--121111121211111111--11111111111111---111-1-1111111---------------11111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111----11-1---111111-1-111111111----111111111--1-1-------------111111111111-1111111111111111111-1111-1111111111-11111111--1111111111--1111111111111111111111111-1121111111112112121222111111111111111111111111111111111---11111---------------------11111111111111111111111111222221111111111111111111111111111111111111111111111-111111111111111111111111111112111111111111-1-------1111111111111111111111111111111111111-1-111111111111111111111111111-111111111111111111111111221111111111111111111111111--111111111111---1-----111111111111111111111111111-11111111111111111111111111--------111111111111122111111111111111111111111-------------------------------------11--11111111 ------1-11--11111111111121111111111111111111112121222221111111-11111-1111111111111111111-11111121111121112-11-21212111111111211B1AP2-542-1-121112-1-1-11-2131-2132131111112--11111181111111221121121111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAV:Sequence :TccEEEEEccccHHHHHHHHHHHHHHccEEEEEEEccccccccHHHHHHHHHHHHHccEE:Sec Str : ######### :PROS|8->16|PS00564|ARGININOSUCCIN_SYN_1|PDOC00488| : =========================================================:RP:SCP|4->166|1j1zA1|9e-61|50.0|162/165|c.26.2.1 :============================================================:BL:SWS|1->399|ASSY_THEFY|0.0|100.0|399/399 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->390|PF00764|e-119|54.9|384/390|Arginosuc_synth 61: . . . * . .: 120 :IADAKEEFANDYCVPAIQANALYMDRYPLVSALSRPLIVKHLAEAARYHGATMVAHGCTG:Sequence :EEcTHHHHHHHTHHHHHHHHHTTccccHHHHHcccccTTHHHHHHHTTcccccEEccEEE:Sec Str : ####:PROS|117->128|PS00565|ARGININOSUCCIN_SYN_2|PDOC00488| :============================================================:RP:SCP|4->166|1j1zA1|9e-61|50.0|162/165|c.26.2.1 :============================================================:BL:SWS|1->399|ASSY_THEFY|0.0|100.0|399/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->390|PF00764|e-119|54.9|384/390|Arginosuc_synth 121: . . + . . .: 180 :KGNDQVRFEAGLAALFPELKVLAPVRDSGMTRDKAIAFAEEKGLPIDVTKKSPYSIDQNL:Sequence :EcccTTcccGGGGTTccHHHHHTEEccGGccHHHHHHHHHHHTcTTcccHHHcccccccc:Sec Str :######## :PROS|117->128|PS00565|ARGININOSUCCIN_SYN_2|PDOC00488| :============================================== :RP:SCP|4->166|1j1zA1|9e-61|50.0|162/165|c.26.2.1 : =======:RP:SCP|174->397|1k92A2|7e-53|25.9|224/256|d.210.1.1 :============================================================:BL:SWS|1->399|ASSY_THEFY|0.0|100.0|399/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->390|PF00764|e-119|54.9|384/390|Arginosuc_synth 181: . * . . . .: 240 :FGRAVETGFLEDIWNGPIEDIYDYTQNPAEPREPDEVVITFTAGVPTALDGKELSPLEII:Sequence :cccccHHHHHTTTccccccEEEcccccEEEccccTTccTTccTTccEEEEEcTTcTTTcc:Sec Str :============================================================:RP:SCP|174->397|1k92A2|7e-53|25.9|224/256|d.210.1.1 :============================================================:BL:SWS|1->399|ASSY_THEFY|0.0|100.0|399/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->390|PF00764|e-119|54.9|384/390|Arginosuc_synth 241: + . . . . *: 300 :QELNRRAGAQGVGRIDMVEDRLVGIKSREVYEAPGAITLITAHQELENVTVERELARFKR:Sequence :cccccccccccEEEEETTTTEEEEEcccTTcGGGEEEEEEEccccccEEEEEEcccTTcc:Sec Str :============================================================:RP:SCP|174->397|1k92A2|7e-53|25.9|224/256|d.210.1.1 :============================================================:BL:SWS|1->399|ASSY_THEFY|0.0|100.0|399/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->390|PF00764|e-119|54.9|384/390|Arginosuc_synth 301: . . . . + .: 360 :WVDQRWGELVYDGLWFSPLKNALDKFILEANKHVTGDIRMVLHGGRAVVTGRRSEASLYD:Sequence :cEEEEEEEcccccEEEEHHHHHHHHTEEEEEETccTTccccEEccccEEEcccEEEEEEH:Sec Str :============================================================:RP:SCP|174->397|1k92A2|7e-53|25.9|224/256|d.210.1.1 :============================================================:BL:SWS|1->399|ASSY_THEFY|0.0|100.0|399/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->390|PF00764|e-119|54.9|384/390|Arginosuc_synth 361: . . . * . .: 420 :YHLATYDSGDTYDQSLARGFIDIWSMPAKIANMRDRRLS :Sequence :HHHHHHHccccEEcccccccccTTcEEEEcccccc :Sec Str :===================================== :RP:SCP|174->397|1k92A2|7e-53|25.9|224/256|d.210.1.1 :======================================= :BL:SWS|1->399|ASSY_THEFY|0.0|100.0|399/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->390|PF00764|e-119|54.9|384/390|Arginosuc_synth