[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56165.1"

            "carbonic anhydrase, putative"
            ""

OrgPattern --------1-----1---------1---1---1111-111112------------------------- -2--3---------11111-11--311111111111-11113211------------1----1-1111111---------1-1-----1111-1---------------------------------------------11--------1------1------------------------------------2-----1--1----2-112212--2---1111------111--------------1------------------------------11111111111111111111111111111111111111111111----1-------1-1-1---1111-------1----1-------------------------1----1--1----------------------------------------------------------------------------------------------------------------------------11------------------------------------1-1111111---------------------111-111-11111-1----------------------------1----------1----------------------1---------------------------------------------------11----------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------11- ---------------111--11-1--1--1111---11111111111-133132--1111--------------1------111-----1211-1---------------------------------------------------------------------------------11-----21----1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNGVFDDVLAANEDYVRTFTLAGLQPVAARGLALVTCMDSRIEPLEMLGLKPGDAKILRN:Sequence : HHHHHHHHHHHHHHHHHHHcccccccccEEEEEETTccccHHHHTTccTTcEEEEEE:Sec Str : =========================================================:RP:SCP|4->166|1g5cA|5e-33|32.5|160/169|c.53.2.1 : =========================================================:BL:SWS|4->165|Y1315_MYCBO|5e-22|36.1|158/163 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->162|PF00484|8e-13|38.0|129/149|Pro_CA 61: . . . * . .: 120 :AGARVTDDTLRTLVLAVYLLGVNRVIVLPHTGCKMASVSGDEEVHDTIAARYGVDTRSLE:Sequence :TTccccHHHHHHHHHHHHTccccEEEEEEEcccHHHHHHHccccccHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|4->166|1g5cA|5e-33|32.5|160/169|c.53.2.1 :============================================================:BL:SWS|4->165|Y1315_MYCBO|5e-22|36.1|158/163 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->162|PF00484|8e-13|38.0|129/149|Pro_CA 121: . . + . . .: 180 :FHTDSDQIGALHRDVERIRHHPLLPPDLPVMGAIYDVDTGRVTPVDM :Sequence :TccGGGHHHHHHHHHHHHHHcHHHHcccEEEEEEEETTTTEEEEccc :Sec Str :============================================== :RP:SCP|4->166|1g5cA|5e-33|32.5|160/169|c.53.2.1 :============================================= :BL:SWS|4->165|Y1315_MYCBO|5e-22|36.1|158/163 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|34->162|PF00484|8e-13|38.0|129/149|Pro_CA