[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56191.1"

            "putative long-chain-fatty-acid-CoA ligase"
            ""

OrgPattern 66-3--AILJLLKJHD1174642KC665327C3261--333317676954433----1---366---3 58C7h786556G6Ci*kTT-Sm99*xTTTTTXytzun***4fHh53264A71E8GAAE--WOO4hOlZRgC4343444-4AAJ224329865-7221--43A223H234511111111111111154556424565DDDEF333b8ABF6GGH22332224324226LDW6222222232222856AA--3E9RFFGFGJDJDGFHILD88FFHLFGKBJDEC46333333U32777777777777776554521212212111122211121333332111213115212211111111111111111111111112211121---51111411112M-77------71-93271DB5263--B31111-21926PEEK1111197gXl747cReWR45554454556-GFLGEPEFAKN-AAAE9A9B8DB9DL9D8DEL8BA9DDI44444444C3114EC9----------111111111111111----4GKhH-8NLCJJPRQRURJLLGIGNTbbbYDUZHgZnrc46IIFDEFIFYFORaS33G2143B62222222659JDE5rOH96986A7666-9A95A4657BCDAiQB932211222212131-11-1112327229C37B69597788888EBC9998B8C88CC--14A84------B7JA875999C9CCA98-89A999A9AA9AA998998879BAQX69788999999889889B57677871-677767666566---52324299985BT4933324313332311499BA95C9BAI5NQMORPLLEHGKIBGFP5444444542566E999999969A66644444442222--527744552222222241------------------------------------2A1 5333JQ9-PB819ALWURPbOROgfdpONKQKNMOLTPQPONPNPPNFNRTYYeOLQMHKIHF385445765537654555555A544-HPCUMHD7566B9HRRU3FKDnLZJWJPD99BBNDjX8UEx*S3YOfDFAEOCEOG8FEA7N93U8LFHWKNbIjNcIgIdWMQcK57B8*A8AGBYYe*Nld9CQMMKN -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACP:Sequence :HccHHHHHHHHHHHcTTcEEEEEGGGTEEEEHHHHHHHHHHHHHHHTTccTTcEEEEEcc:Sec Str : ======================================================:RP:SCP|7->515|1md9A|e-101|29.8|493/536|e.23.1.1 : ===========================================================:BL:SWS|2->515|LCFB_BACSU|e-105|43.1|504/513 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->448|PF00501|5e-76|45.3|393/405|AMP-binding 61: . . . * . .: 120 :NVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ:Sequence :ccHHHHHHHHHHHHHTcEEEEEcTTccHHHHHHHHHHTTccEEEEcccHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|7->515|1md9A|e-101|29.8|493/536|e.23.1.1 :============================================================:BL:SWS|2->515|LCFB_BACSU|e-105|43.1|504/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->448|PF00501|5e-76|45.3|393/405|AMP-binding 121: . . + . . .: 180 :AFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSG:Sequence :ccEEEEHHHHEcccTTcccHTccTHHHHHHETTEEcccccccccccccTTcEEEEEEEcc:Sec Str : ######:PROS|175->186|PS00455|AMP_BINDING|PDOC00427| :============================================================:RP:SCP|7->515|1md9A|e-101|29.8|493/536|e.23.1.1 :============================================================:BL:SWS|2->515|LCFB_BACSU|e-105|43.1|504/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->448|PF00501|5e-76|45.3|393/405|AMP-binding 181: . * . . . .: 240 :TTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHG:Sequence :cccccEEEEEEGGGHHHHHHHHHHTccccccTTcEEEEcccTTcHHHHHTTHHHHHHTTc:Sec Str :###### :PROS|175->186|PS00455|AMP_BINDING|PDOC00427| :============================================================:RP:SCP|7->515|1md9A|e-101|29.8|493/536|e.23.1.1 :============================================================:BL:SWS|2->515|LCFB_BACSU|e-105|43.1|504/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->448|PF00501|5e-76|45.3|393/405|AMP-binding 241: + . . . . *: 300 :TMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGAS:Sequence :EEEEcccccHHHHHHHHHHHTccEEEEcHHHHHHHHHHHHHTcTTcccTTccEEEEcccc:Sec Str :============================================================:RP:SCP|7->515|1md9A|e-101|29.8|493/536|e.23.1.1 :============================================================:BL:SWS|2->515|LCFB_BACSU|e-105|43.1|504/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->448|PF00501|5e-76|45.3|393/405|AMP-binding 301: . . . . + .: 360 :LPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENF:Sequence :ccHHHHHHHHHHcccEEEEEEEETTTEEEEEEEcccccccEEcccTTccEEEEcTTccTc:Sec Str :============================================================:RP:SCP|7->515|1md9A|e-101|29.8|493/536|e.23.1.1 :============================================================:BL:SWS|2->515|LCFB_BACSU|e-105|43.1|504/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->448|PF00501|5e-76|45.3|393/405|AMP-binding 361: . . . * . .: 420 :NTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD:Sequence :cccTTccEEEEEEccTTcccccTTcHHHHHHHEETTEEEEEEEEEEcTTccEEEEEEccc:Sec Str :============================================================:RP:SCP|7->515|1md9A|e-101|29.8|493/536|e.23.1.1 :============================================================:BL:SWS|2->515|LCFB_BACSU|e-105|43.1|504/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->448|PF00501|5e-76|45.3|393/405|AMP-binding 421: . . + . . .: 480 :MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIA:Sequence :cEEETTEEEcHHHHHHHHTTcTTEEEEEEEEEEETTTEEEEEEEEEEcTTcccHHHHHHH:Sec Str :============================================================:RP:SCP|7->515|1md9A|e-101|29.8|493/536|e.23.1.1 :============================================================:BL:SWS|2->515|LCFB_BACSU|e-105|43.1|504/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|30->448|PF00501|5e-76|45.3|393/405|AMP-binding 481: . * . . . .: 540 :WAKERLAAYKYPRIVEFRTELPMTATGKILKRELR :Sequence :HHHccccGGGcccEEEEcccccccTTccccHHHHH :Sec Str :=================================== :RP:SCP|7->515|1md9A|e-101|29.8|493/536|e.23.1.1 :=================================== :BL:SWS|2->515|LCFB_BACSU|e-105|43.1|504/513