[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56219.1"

            "Sfr protein"
            ""

OrgPattern -------------------------------------------------------------------- 222122------1-21111-11111-1111112---21222222---11------1-111--1-1-11232-------3211322111111111111----111-1-1111111111112111111121111211123334---222212221222222122211112222221-22222-221--111123343333344454445444366324443334322555555331222222222222223222211212212212221122-2211-111111----21111111111111-------------11122211112432344444442432233322223312322223332222212333211112-2112-----------11-1---11111111111-11-11-1---2-1--1------11-11121222222121111111111222211111--------11111111111111111111111122222212211111111111111111111111112222212122221122112222222111111122222222221211222222222222221222122222--111-------------1------222222222222222222223222222322221-211221--11122222222222222222-223222222222212222222222222222222222222222222222222212222222222222222111112222222222222222222222222222222222222222222212222222211111111123332222223322233222222222222112111----1111121222--------------------------11111-11-1211 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIRKARMSLRFAQAMRLPAPLPHVSQVAARMLPRHLDGVLLGAAVTLSMVGALLVWSATL:Sequence 61: . . . * . .: 120 :PPTGHAGPTVYAWRHLGHLLLALPLCLALASLTRRALRAYTPVLFVAVTVALLLVLGPLG:Sequence : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|76->99|lghlllalplclalasltrralra : XXXXXXXXXXXXXXXXXXX:SEG|102->123|pvlfvavtvalllvlgplgetv 121: . . + . . .: 180 :ETVNGSRSWIALGDLRVQPAETAKIALILAVAAVLGRPRPRTPRPPASDVLISLGVAAVP:Sequence :XXX :SEG|102->123|pvlfvavtvalllvlgplgetv : XXXXXXXXXXX :SEG|145->155|ialilavaavl : XXXXXXXXXX :SEG|157->166|rprprtprpp : ========================================================:BL:SWS|125->396|RODA_HAEIN|1e-30|30.3|267/371 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|124->393|PF01098|5e-34|37.6|266/357|FTSW_RODA_SPOVE 181: . * . . . .: 240 :IGLILLQPDLGSALVLTAIYLALLACSGAPLRWPLALLGCGAFTGLAVWQLGLLKDYQVA:Sequence :============================================================:BL:SWS|125->396|RODA_HAEIN|1e-30|30.3|267/371 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|124->393|PF01098|5e-34|37.6|266/357|FTSW_RODA_SPOVE 241: + . . . . *: 300 :RFTAFLDPHADPLGAGYNVNQALIAVGSGGLSGSGLFHGGQTSGKFVPEQHTDFVFSVAA:Sequence : XXXXXXXXXXXXXX :SEG|267->280|gsgglsgsglfhgg :============================================================:BL:SWS|125->396|RODA_HAEIN|1e-30|30.3|267/371 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|124->393|PF01098|5e-34|37.6|266/357|FTSW_RODA_SPOVE 301: . . . . + .: 360 :EELGFAGGCAVIVLLGVVLLRILRVASRCDEVHGRLVCIGVAAWFCVQVFVNIGMTLGLT:Sequence : XXXXXXXXXXXXXXX :SEG|311->325|vivllgvvllrilrv : XXXXXXX:SEG|354->368|gmtlgltpvtglplp : #########:PROS|352->376|PS00428|FTSW_RODA_SPOVE|PDOC00352| :============================================================:BL:SWS|125->396|RODA_HAEIN|1e-30|30.3|267/371 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|124->393|PF01098|5e-34|37.6|266/357|FTSW_RODA_SPOVE 361: . . . * . .: 420 :PVTGLPLPFVSYGGSAAVANFAALGLVMAVHAHNEERRSLEPAGTRG :Sequence :XXXXXXXX :SEG|354->368|gmtlgltpvtglplp :################ :PROS|352->376|PS00428|FTSW_RODA_SPOVE|PDOC00352| :==================================== :BL:SWS|125->396|RODA_HAEIN|1e-30|30.3|267/371 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|124->393|PF01098|5e-34|37.6|266/357|FTSW_RODA_SPOVE