[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ56219.1 tfus0 AAZ56219.1 "Sfr protein"
MIRKARMSLRFAQAMRLPAPLPHVSQVAARMLPRHLDGVLLGAAVTLSMVGALLVWSATL
PPTGHAGPTVYAWRHLGHLLLALPLCLALASLTRRALRAYTPVLFVAVTVALLLVLGPLG
ETVNGSRSWIALGDLRVQPAETAKIALILAVAAVLGRPRPRTPRPPASDVLISLGVAAVP
IGLILLQPDLGSALVLTAIYLALLACSGAPLRWPLALLGCGAFTGLAVWQLGLLKDYQVA
RFTAFLDPHADPLGAGYNVNQALIAVGSGGLSGSGLFHGGQTSGKFVPEQHTDFVFSVAA
EELGFAGGCAVIVLLGVVLLRILRVASRCDEVHGRLVCIGVAAWFCVQVFVNIGMTLGLT
PVTGLPLPFVSYGGSAAVANFAALGLVMAVHAHNEERRSLEPAGTRG
//