[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56286.1"

            "aminotransferase"
            ""

OrgPattern 33--22122222222154132224533433541-133-111116544544655-33344441221-23 4452223334423234333-3311543233353555475434444244133178633411342-545566336666552123242433345322--1--42434342333---------------22244312124333222223332354433333121222243455641221---3112-1221211154433333334433333312333433346533333333333511111111111111-1111142123327131554433-324743333332122333333333333332222222222222332333333324263333333333222222222323-21422222245212343342112332444411111318565534444433333333335-557557565B216445659766566623235434325485555555554445546111111111111111111111111111112145233A7456445475455555555455554565557-243955655454354333332214222222222434316541447155556-121232343443524371211222222111111111112122221112522121-1211111111111111112---3542------34441433333333333-3343333333323333333564321113333233333333333322233331-333343344444--1111111333346362111112-1111111144444341115155657979576664665422223222211111111111111223232222312222242111111------------------------------------3222223222352 ----1-4-32--2232322353332353323223212333222323124533431231311111121--1-141211-11-11-21-1-253321233233-2444-2314343433-3212227217-392-311112-3--73111-14-13153221-2-313-433144242123R554239ACL2F35387993 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSVAVSATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGI:Sequence :ccccHHHHHHHHHHHHHHHcTTcccEEcccccccccccHHHHHHHHHHHHHcccccTTcc:Sec Str : ====================================:RP:SCP|25->417|1d2fA|9e-27|14.6|355/361|c.67.1.3 : ===========================================================:BL:SWS|2->376|AAT_THEAQ|2e-39|34.4|349/383 : $$$$$$$$$$$$$$$:RP:PFM|46->280|PF00155|2e-19|38.1|223/341|Aminotran_1_2 61: . . . * . .: 120 :RELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHL:Sequence :HHHHHHHHHHHHHTTTTccGGGEEEEccHHHHHHHHHHHHcTTccEEEcccTHHHHHHHH:Sec Str :============================================================:RP:SCP|25->417|1d2fA|9e-27|14.6|355/361|c.67.1.3 :============================================================:BL:SWS|2->376|AAT_THEAQ|2e-39|34.4|349/383 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->280|PF00155|2e-19|38.1|223/341|Aminotran_1_2 121: . . + . . .: 180 :SGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRR:Sequence :HTccccEETTTTEETTcEEEccGGGTTcccGGGcccccEEEEEcccTTTcccccHHHHHH:Sec Str :============================================================:RP:SCP|25->417|1d2fA|9e-27|14.6|355/361|c.67.1.3 :============================================================:BL:SWS|2->376|AAT_THEAQ|2e-39|34.4|349/383 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->280|PF00155|2e-19|38.1|223/341|Aminotran_1_2 181: . * . . . .: 240 :LTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIGVA:Sequence :HHHHHHHHTcEEEEEcTTGGGccccccccGGGcTTGGGTEEEEEEcHHHHcTTTTccEEE:Sec Str : ############## :PROS|225->238|PS00105|AA_TRANSFER_CLASS_1|PDOC00098| :============================================================:RP:SCP|25->417|1d2fA|9e-27|14.6|355/361|c.67.1.3 :============================================================:BL:SWS|2->376|AAT_THEAQ|2e-39|34.4|349/383 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->280|PF00155|2e-19|38.1|223/341|Aminotran_1_2 241: + . . . . *: 300 :RLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGLVAR:Sequence :EccTTcTcccHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXX:SEG|298->311|varavaerfraagv :============================================================:RP:SCP|25->417|1d2fA|9e-27|14.6|355/361|c.67.1.3 :============================================================:BL:SWS|2->376|AAT_THEAQ|2e-39|34.4|349/383 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|46->280|PF00155|2e-19|38.1|223/341|Aminotran_1_2 301: . . . . + .: 360 :AVAERFRAAGVPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRMLLDRYGMGVLPA:Sequence :HHHHHHHHTTccEEEcccccEEEEEcTTccHccccGGGTcccHHHHHHHHHHHcEEcEEG:Sec Str :XXXXXXXXXXX :SEG|298->311|varavaerfraagv :============================================================:RP:SCP|25->417|1d2fA|9e-27|14.6|355/361|c.67.1.3 :============================================================:BL:SWS|2->376|AAT_THEAQ|2e-39|34.4|349/383 361: . . . * . .: 420 :VEFGESTHALRVRVATSLLYGESEAQRYSALAAEDPTALPWIRAHLDRISEVLDEVRQEQ:Sequence :GGGcGGGTTEEEEccccEEccccHHHcTTcccHHHEcccccHHHHHHHHGGGGGGHcccc:Sec Str :========================================================= :RP:SCP|25->417|1d2fA|9e-27|14.6|355/361|c.67.1.3 :================ :BL:SWS|2->376|AAT_THEAQ|2e-39|34.4|349/383 421: . . + . . .: 480 :PAVAVPAMAS :Sequence :cEEEEEccc :Sec Str