[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56387.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------1------------------ --------111---1---------------------1221---11----12-111-----------11111-------------------------1----3----21-1----------------------------------1------------------------1----------------------------------------1--1-------1---11111132-11111111111111-----1----------------------111----------------------------------------------------------------------------------------------1-----1-------2---------1----------1----------1---11---11--11--------1111----------------------------------------------------2--1111111111-----1111------1-1111------11---111-1---------------------1-2-------------------------1-12------------------------------------------------1111----1----------------------------------------------------------------------------1-----------------------------------------------------------------1-----------------------------------------11----------------------------------------------------------------------- ------------------------------------1----11-----11---1--------------------------------------------------------------------------------------------------------------------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTRKIFVNVAVQDLQKSQEFFTALGFRFDPRFTDTNAACMVINDDCAVMLLTRDFFRRFT:Sequence :ccccccEEEEEccHHHHHHHHHTTccccGGGGGccEEEEEcTTccEEEEEEHHHHHHHcT:Sec Str : XXXXXXXXX:SEG|52->61|trdffrrftr :============================================================:RP:SCP|1->131|1twuA|2e-11|9.4|128/137|d.32.1.8 61: . . . * . .: 120 :RKELVDAAKNTESIISVSADRKEEVDELVNRAFEAGARPSIDPIENEGMYAWGFQDLDGH:Sequence :TccccccccccccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEETTTEEEEEEEcTTcc:Sec Str :X :SEG|52->61|trdffrrftr :============================================================:RP:SCP|1->131|1twuA|2e-11|9.4|128/137|d.32.1.8 121: . . + . . .: 180 :LWEVVWMDPRALEA :Sequence :EEEEEEEcTTcHHH :Sec Str :=========== :RP:SCP|1->131|1twuA|2e-11|9.4|128/137|d.32.1.8