[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56411.1"

            "dihydroorotate oxidase B, electron transfer subunit"
            ""

OrgPattern -------------------------------------------------------------------- ----2----------------------------------------11-------------11--3--2-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSAIRSSRIARLGVVGLLLYALTTPAPALADPSPDNNSAPSPAARAEQDFRWSVAPSNEN:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|17->44|lllyalttpapaladpspdnnsapspaa : $$$$$$$$$:RP:PFM|52->163|PF06030|7e-06|28.2|110/122|DUF916 61: . . . * . .: 120 :GELGRSYFVHDVKPGQTIEDWVAITNYGEEPMTFSVYGTDAFNTPDGSFALLPADEEPAL:Sequence : XXXXXXXXXXX:SEG|110->121|allpadeepala : =================================================:RP:SCP|72->170|1g0dA2|8e-07|12.0|83/109|b.1.5.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->163|PF06030|7e-06|28.2|110/122|DUF916 121: . . + . . .: 180 :AGTWIEIPREDQTVEVKGGETRVIPFTITVPDNAEPGDHAAGVIASVSHDALNAQGQLVR:Sequence :X :SEG|110->121|allpadeepala :================================================== :RP:SCP|72->170|1g0dA2|8e-07|12.0|83/109|b.1.5.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|52->163|PF06030|7e-06|28.2|110/122|DUF916 181: . * . . . .: 240 :VDRRIAARVYLRVDGPVRPSLHIDAIRTDYQAPPWWNPFATGEVTITYQVRNAGNLRLTA:Sequence 241: + . . . . *: 300 :SGEAGAAGPFGVGLGDPVHKDVPEMLPGTVYEYTHTIPDIYPLFWINGEVTLTPQAAPQS:Sequence : ==============================================:BL:SWS|255->303|PRP8_DICDI|3e-04|45.5|44/100 301: . . . . + .: 360 :AQTPDLHPVTRGDSVIAIPWLPVLAAILLTAVLIWRRRHAKRRFQAAVAAAVAEARKQDA:Sequence : XXXXXXXXXXXXXX :SEG|321->334|lpvlaailltavli : XXXXXXXXXXXXXXXXXXXXX:SEG|340->361|akrrfqaavaaavaearkqdaa :=== :BL:SWS|255->303|PRP8_DICDI|3e-04|45.5|44/100 361: . . . * . .: 420 :AHQGAPQTTAAEAPADPTTDSPEQQPDSAAHQGGSANEQTEPEEPRS :Sequence :X :SEG|340->361|akrrfqaavaaavaearkqdaa : XXXXXXXXXXXXXXXXXX :SEG|365->382|apqttaaeapadpttdsp