[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ56411.1 tfus0 AAZ56411.1 "dihydroorotate oxidase B, electron transfer subunit"
MSAIRSSRIARLGVVGLLLYALTTPAPALADPSPDNNSAPSPAARAEQDFRWSVAPSNEN
GELGRSYFVHDVKPGQTIEDWVAITNYGEEPMTFSVYGTDAFNTPDGSFALLPADEEPAL
AGTWIEIPREDQTVEVKGGETRVIPFTITVPDNAEPGDHAAGVIASVSHDALNAQGQLVR
VDRRIAARVYLRVDGPVRPSLHIDAIRTDYQAPPWWNPFATGEVTITYQVRNAGNLRLTA
SGEAGAAGPFGVGLGDPVHKDVPEMLPGTVYEYTHTIPDIYPLFWINGEVTLTPQAAPQS
AQTPDLHPVTRGDSVIAIPWLPVLAAILLTAVLIWRRRHAKRRFQAAVAAAVAEARKQDA
AHQGAPQTTAAEAPADPTTDSPEQQPDSAAHQGGSANEQTEPEEPRS
//