Summary of "tfus0:AAZ56415.1"

            "hypothetical protein"

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   

1: . . . . + .: 60 :MYGLIWRLIPGPWVVKLVVCLALIAGAAALLWYVVFPWADPYLPFNDVTVEGDESVYGMT:Sequence : XXXXXXXXXXXXXXX :SEG|17->31|lvvclaliagaaall 61: . . . * . .: 120 :PEPDTDG :Sequence