[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56417.1"

            "ABC-type hemin transport system ATPase component"
HMUV_THEFY  "RecName: Full=Hemin import ATP-binding protein hmuV;         EC=3.6.3.-;"

OrgPattern 44311212222222434-441428A466A88A11244121212588AE45C8222335542-314-21 65C1S99AFFEC6641311-19113J1111119777AIIE6A8JBID7D793GBC5AA22EFBELGAIQXA34445447254D2-11-557314451--22312334752-------1-1----434236424434CCCCB215BA7647445BB44621582866D7883212222112122IMIDA44-C67BBBBBA9BBAB999ACA77BBAAB59CC758BBBB99HB422333212222222366235461A81333344238A4213522235667344545566767656566555566666655856554666687987999B9AA4C85755555675644I4555IG66345437648937382677774334453ZMK77GKDIOBIGHHHCIIJGQ-CBIB8QEEGf11oXXORVVllgYYQK233JKZKDJJJG944444444I794-6BE------------2222222222222----223532DKHCLHHIMJHADEEDIIMJFDEFBBMDZEKIF14BA9JAABCJGIHWi57954449A33333335759AA5DE456D9888A983735533566CCABFJ5C1342133332-32222333322312679A6654145416677654575696755984--25535------J9HH5CCCFFGCGFICB-ECCCEEGCHDEGFDDCDDBLMNGK677CCDCDEEEEEDDEDCDJABCCCAC7-BBCCDCCDADDD-12511111-121337AD5566571233164673344334155C378878D7D8AA954BAD2122222218776699999A8C773323233333------3221--111111-111712-112------------------1112432336423235 -----1-------1-----1---1-1-11----1111111111111112211213121-1111-------------------------------1-------1--------1------------23-2-------------1-11-------------2----1---------1----17-11--1117-23--1--2- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKRIRQTMRAVVHGSGLRRLTPPQRVTSGTVVLGARHLSKSYGARTVLDDVSLDVRTGEV:Sequence : =========================:RP:SCP|36->262|1b0uA|3e-33|26.9|227/258|c.37.1.12 :============================================================:BL:SWS|1->284|HMUV_THEFY|e-125|100.0|284/284 61: . . . * . .: 120 :LALVGPNGAGKSTLLSILTGDTPPDRGEVTVLDRPLAAWSPAELALRRAVLPQSFTVSFP:Sequence :============================================================:RP:SCP|36->262|1b0uA|3e-33|26.9|227/258|c.37.1.12 :============================================================:BL:SWS|1->284|HMUV_THEFY|e-125|100.0|284/284 121: . . + . . .: 180 :FDVVDVVHMGRAPWAAVDVDVDDDRVVADAMAATEVTALAARKFPSLSGGEKARVMLARV:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|135->161|aavdvdvdddrvvadamaatevtalaa : ##############:PROS|167->181|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|36->262|1b0uA|3e-33|26.9|227/258|c.37.1.12 :============================================================:BL:SWS|1->284|HMUV_THEFY|e-125|100.0|284/284 : $$$$$$$$$$$$$$$$$$:RP:PFM|163->195|PF00005|6e-05|45.5|33/123|ABC_tran 181: . * . . . .: 240 :LAQQTQIMLWDEPTAALDIRHQESVLRIARQRAAQGDAIVVVLHDLALAAAYADQVAILS:Sequence : XXXXXXXXXXXXXXXXXXXXXXX :SEG|217->239|daivvvlhdlalaaayadqvail :# :PROS|167->181|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|36->262|1b0uA|3e-33|26.9|227/258|c.37.1.12 :============================================================:BL:SWS|1->284|HMUV_THEFY|e-125|100.0|284/284 :$$$$$$$$$$$$$$$ :RP:PFM|163->195|PF00005|6e-05|45.5|33/123|ABC_tran 241: + . . . . *: 300 :QGQIAAYGPPAEVFTAKLLSDVYSYEVEIVSHPRTGVPLVLPVR :Sequence :====================== :RP:SCP|36->262|1b0uA|3e-33|26.9|227/258|c.37.1.12 :============================================ :BL:SWS|1->284|HMUV_THEFY|e-125|100.0|284/284